LXL04_029472 | RubberDandelionOmics

Gene overview

LXL04_029472

Reference: OH-1004 Chr: Chr06 Coordinates: 91600957-91603096 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

915 bp · LXL04_029472|LXL04_029472|OH1004|cDNA

ATGGACAGGCCTCACTGGCCACAGGAGATAGTGGTGAAGCCAATGGAACAAATAGTAGTACCCAACACCAACACCACAAACTCAAATAACAATTTTAACAATCTCTCAAAGCCATCTTCAAGCTCTTCCTCTTTTGAAAGAAGGCTAAGACCACAAAAAGCTGCCGCCGTCAACTGTCCGAGGTATTGGACCGAAGGAGGGACACTCAGAAACATCCCGGTTGGCGGCGGTTCAAGAAAGAACAAGcgatcatcatcttc...

CDS

Download CDS FASTA

915 bp · LXL04_029472|LXL04_029472|OH1004|CDS

ATGGACAGGCCTCACTGGCCACAGGAGATAGTGGTGAAGCCAATGGAACAAATAGTAGTACCCAACACCAACACCACAAACTCAAATAACAATTTTAACAATCTCTCAAAGCCATCTTCAAGCTCTTCCTCTTTTGAAAGAAGGCTAAGACCACAAAAAGCTGCCGCCGTCAACTGTCCGAGGTATTGGACCGAAGGAGGGACACTCAGAAACATCCCGGTTGGCGGCGGTTCAAGAAAGAACAAGCGATCATCATCTTC...

Protein

Download Protein FASTA

304 aa · LXL04_029472|LXL04_029472|OH1004|PROTEIN

MDRPHWPQEIVVKPMEQIVVPNTNTTNSNNNFNNLSKPSSSSSSFERRLRPQKAAAVNCPRYWTEGGTLRNIPVGGGSRKNKRSSSSSSTTSSSQTSVSKKLSDLVVPSASTSVLSGNPRIHHDRYGQDLNLGNTNSSASTTTSASLSAMELLTGITARGTTNNCLMPIPIADPNSVYSQSAQLMIPMPEFKIPTSLSFSIDGMATGGGGGGSGGGGTYGIALHDRRLLFPFEELKSNASTNLDDQHVGQDRDQNDEIQD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029472`
TK1151 ID	TkA07G314540
OH-1004 ID	LXL04_029472
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.500
Protein coverage (%)	TK1151 94.754 / OH-1004 83.882 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029472

Location Chr06:91600957-91603096 (-)

Description Similar to DOF4.6: Dof zinc finger protein DOF4.6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24060`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At3g61850`	Transcription factor specifically involved in the maternal control of seed germination.	No verified direct reference in this release
`At1g64620`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0567800`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release
`Os02g0673700`	Transcription factor that may transactivate seed storage protein genes in developing seeds.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029472 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009639 response to red or far red light Biological Process

GO:0009845 seed germination Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003682 chromatin binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G64620

ath:AT3G61850

ath:AT4G24060

dosa:Os02g0673700

dosa:Os04g0567800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.903

Rank 1 · LXL04_029472 · OH-1004

Cytoplasm0.163

Rank 2 · LXL04_029472 · OH-1004

Cell membrane0.039

Rank 3 · LXL04_029472 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_029472 · OH-1004

Mitochondrion0.013

Rank 5 · LXL04_029472 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701.21Zn_ribbon_Dof58-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029472	`PF02701.21`	Zn_ribbon_Dof	58	83	4.1e-10	40.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LAP8`	Arabidopsis thaliana	Dof zinc finger protein DOF4.6	43.787%	Swiss-Prot	weak database homology
`Q43385`	Arabidopsis thaliana	Dof zinc finger protein DOF3.7	33.333%	Swiss-Prot	moderate database homology
`Q84JQ8`	Arabidopsis thaliana	Dof zinc finger protein DOF1.8	40.952%	Swiss-Prot	weak database homology
`Q9SXG8`	Oryza sativa subsp. japonica	Dof zinc finger protein 1	31.098%	Swiss-Prot	moderate database homology
`B9F1L8`	Oryza sativa subsp. japonica	Dof zinc finger protein 2	27.273%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card