RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_025852
Reference: OH-1004 Chr: Chr05 Coordinates: 117638539-117641616 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3078 bp · LXL04_025852|LXL04_025852|OH1004|cDNA

ATGGTTGCTGTATCGAAGATATGGGTGCTTGTGATTGTACTTCTGGTTTCTCTTCAAAATCAGATTCTAGTGAGTTCACAGAATCCGACATGCAATTCCGATGACCTGAGAGGATTGCAGGGTTTCATGGACGGAGTGGAATCGTCTGTTGTCCGGTGGTGGCCAACGAATTCGTCATCTTCAGCCTCTCTTAATTGCTGCAACTGGGTAGGGATCACATGCAATAACACTTCTGGTAGGGTTGTTGGATTAGAACTTCC...

CDS

Download CDS FASTA

3078 bp · LXL04_025852|LXL04_025852|OH1004|CDS

ATGGTTGCTGTATCGAAGATATGGGTGCTTGTGATTGTACTTCTGGTTTCTCTTCAAAATCAGATTCTAGTGAGTTCACAGAATCCGACATGCAATTCCGATGACCTGAGAGGATTGCAGGGTTTCATGGACGGAGTGGAATCGTCTGTTGTCCGGTGGTGGCCAACGAATTCGTCATCTTCAGCCTCTCTTAATTGCTGCAACTGGGTAGGGATCACATGCAATAACACTTCTGGTAGGGTTGTTGGATTAGAACTTCC...

Protein

Download Protein FASTA

1025 aa · LXL04_025852|LXL04_025852|OH1004|PROTEIN

MVAVSKIWVLVIVLLVSLQNQILVSSQNPTCNSDDLRGLQGFMDGVESSVVRWWPTNSSSSASLNCCNWVGITCNNTSGRVVGLELPKKRLTGSLSDSISNLGQLRTLNLSRNFLNGPLPISLFHLPHLEVIDLSRNKFNGVLPVNINLPALKQLHISDNTFSGVLPSGLCVNSTGVRVLRFAMNYFNGTIPSEFGNCTLLEHLCVAANFLSGNIPGFLFRLPRLQELTLQDNQFTVIEGIGNSSSRLVRLDISSNGLSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_025852
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_025852
LocationChr05:117638539-117641616 (+)
DescriptionSimilar to PSKR: Phytosulfokine receptor 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g02220 Phytosulfokine receptor with both a serine/threonine-protein kinase activity and a guanylate cyclase activity.
Disruption and overexpression of Arabidopsis phytosulfokine receptor gene affects cellular longevity and potential for growth.2006 · DOI: 10.1104/pp.106.081109
The phytosulfokine (PSK) receptor is capable of guanylate cyclase activity and enabling cyclic GMP-dependent signaling in plants.2011 · DOI: 10.1074/jbc.m110.168823
The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050
At5g53890 Phytosulfokine receptor with a serine/threonine-protein kinase activity. No verified direct reference in this release
At1g72300 Tyrosine-sulfated glycopeptide receptor with a serine/threonine-protein kinase activity.
Tyrosine-sulfated glycopeptide involved in cellular proliferation and expansion in Arabidopsis.2007 · DOI: 10.1073/pnas.0706403104
The tyrosine-sulfated peptide receptors PSKR1 and PSY1R modify the immunity of Arabidopsis to biotrophic and necrotrophic pathogens in an antagonistic manner.2013 · DOI: 10.1111/tpj.12050
Receptor kinase-mediated control of primary active proton pumping at the plasma membrane.2014 · DOI: 10.1111/tpj.12680
At1g55610 Receptor with a serine/threonine-protein kinase activity.
BRL1, a leucine-rich repeat receptor-like protein kinase, is functionally redundant with BRI1 in regulating Arabidopsis brassinosteroid signaling.2004 · DOI: 10.1111/j.1365-313x.2004.02214.x
BRL1 and BRL3 are novel brassinosteroid receptors that function in vascular differentiation in Arabidopsis.2004 · DOI: 10.1242/dev.01403

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_025852 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0009414 response to water deprivation Biological Process
GO:0009416 response to light stimulus Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009729 detection of brassinosteroid stimulus Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009755 hormone-mediated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0031347 regulation of defense response Biological Process
GO:0045087 innate immune response Biological Process
GO:0045851 pH reduction Biological Process
KEGG gene cross-reference
ath:AT1G55610
ath:AT1G72300
ath:AT2G02220
ath:AT5G53890
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.887
Rank 1 · LXL04_025852 · OH-1004
Endoplasmic reticulum0.081
Rank 2 · LXL04_025852 · OH-1004
Cytoplasm0.058
Rank 3 · LXL04_025852 · OH-1004
Nucleus0.038
Rank 4 · LXL04_025852 · OH-1004
Lysosome / Vacuole0.025
Rank 5 · LXL04_025852 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_886-139 aa
PF23598.2LRR_1490-276 aa
PF13855.13LRR_8104-160 aa
PF12799.14LRR_4223-264 aa
PF13855.13LRR_8319-378 aa
PF24758.2LRR_At5g56370332-402 aa
PF12799.14LRR_4343-382 aa
PF12799.14LRR_4366-408 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_025852PF13855.13LRR_8861393.1e-40136.4
LXL04_025852PF23598.2LRR_14902761.6e-2280.4
LXL04_025852PF13855.13LRR_81041603.1e-40136.4
LXL04_025852PF12799.14LRR_42232643.9e-33113.4
LXL04_025852PF13855.13LRR_83193783.1e-40136.4
LXL04_025852PF24758.2LRR_At5g563703324027.8e-0936.2
LXL04_025852PF12799.14LRR_43433823.9e-33113.4
LXL04_025852PF12799.14LRR_43664083.9e-33113.4
LXL04_025852PF13855.13LRR_84194773.1e-40136.4
LXL04_025852PF13855.13LRR_85325873.1e-40136.4
LXL04_025852PF12799.14LRR_45325683.9e-33113.4
LXL04_025852PF23598.2LRR_145416061.6e-2280.4
LXL04_025852PF00069.32Pkinase73810056.2e-44151.1
LXL04_025852PF07714.24PK_Tyr_Ser-Thr7409622.3e-38132.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9ZVR7Arabidopsis thalianaPhytosulfokine receptor 160.594%Swiss-Protstrong database homology
Q9FN37Arabidopsis thalianaPhytosulfokine receptor 246.520%Swiss-Protmoderate database homology
Q9C7S5Arabidopsis thalianaTyrosine-sulfated glycopeptide receptor 142.924%Swiss-Protmoderate database homology
Q9ZWC8Arabidopsis thalianaSerine/threonine-protein kinase BRI1-like 135.165%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser