LXL04_025320 | RubberDandelionOmics

Gene overview

LXL04_025320

Reference: OH-1004 Chr: Chr05 Coordinates: 109719498-109725212 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2523 bp · LXL04_025320|LXL04_025320|OH1004|cDNA

ATGGGGATTAGTTATTGTTCAAGATTCATCCTTTTCTTAATCATCATCTCCTTGGTACCTGTTTATTCTGATACTAATACTGATAATGAATACAATCCCGGACCTGTAACGTATAATGCAAGGTCAGTTATTGTTAATGGGAATCCGACATTGCTATTCTCGGGTTCAATCCATTATCCTCGTAGCACTCCTGAGATGTGGCCGAATATCCTAAGAATGGCAAAAGAAGGAGGATTAAATACCATCGAAACTTATGTGTT...

CDS

Download CDS FASTA

2523 bp · LXL04_025320|LXL04_025320|OH1004|CDS

ATGGGGATTAGTTATTGTTCAAGATTCATCCTTTTCTTAATCATCATCTCCTTGGTACCTGTTTATTCTGATACTAATACTGATAATGAATACAATCCCGGACCTGTAACGTATAATGCAAGGTCAGTTATTGTTAATGGGAATCCGACATTGCTATTCTCGGGTTCAATCCATTATCCTCGTAGCACTCCTGAGATGTGGCCGAATATCCTAAGAATGGCAAAAGAAGGAGGATTAAATACCATCGAAACTTATGTGTT...

Protein

Download Protein FASTA

840 aa · LXL04_025320|LXL04_025320|OH1004|PROTEIN

MGISYCSRFILFLIIISLVPVYSDTNTDNEYNPGPVTYNARSVIVNGNPTLLFSGSIHYPRSTPEMWPNILRMAKEGGLNTIETYVFWNVHEPVEGQFNFTGNYDLVKFMKLIAENKLYAILRLGPFIQAEWNLGGLPFWLRDVPDIIFRSYNEPYMTHMKRYSEMIINMMKKEKLFAPQGGPIIMAQIENEYNHVQESYREKGIQYVKWAADMATGLYPDVPWIMCKQKDAPPNVISTCNGRHCADTFGGPNGDNKPSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025320`
TK1151 ID	TkA06G067730
OH-1004 ID	LXL04_025320
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025320

Location Chr05:109719498-109725212 (+)

Description Similar to BGAL13: Beta-galactosidase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16730`	Beta-galactosidase 13.	No verified direct reference in this release
`At4g38590`	Beta-galactosidase 14.	No verified direct reference in this release
`At4g35010`	Beta-galactosidase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0549200`	Beta-galactosidase 11.	No verified direct reference in this release
`Os09g0539200`	Beta-galactosidase 12.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025320 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009827 plant-type cell wall modification Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

GO:0030246 carbohydrate binding Molecular Function

KEGG gene cross-reference

ath:AT2G16730

ath:AT4G35010

dosa:Os08g0549200

dosa:Os09g0539200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.360

Rank 1 · LXL04_025320 · OH-1004

Lysosome / Vacuole0.265

Rank 2 · LXL04_025320 · OH-1004

Endoplasmic reticulum0.138

Rank 3 · LXL04_025320 · OH-1004

Cytoplasm0.125

Rank 4 · LXL04_025320 · OH-1004

Cell membrane0.116

Rank 5 · LXL04_025320 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01301.26Glyco_hydro_3543-347 aa

PF02449.22Glyco_hydro_4264-203 aa

PF17834.8GHD375-426 aa

PF13364.13BetaGal_ABD2614-699 aa

PF21467.4BetaGal_gal-bd628-693 aa

PF02140.24SUEL_Lectin753-834 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025320	`PF01301.26`	Glyco_hydro_35	43	347	5e-112	375.3
LXL04_025320	`PF02449.22`	Glyco_hydro_42	64	203	1.3e-08	35.3
LXL04_025320	`PF17834.8`	GHD	375	426	1.4e-17	63.9
LXL04_025320	`PF13364.13`	BetaGal_ABD2	614	699	2.5e-09	38.6
LXL04_025320	`PF21467.4`	BetaGal_gal-bd	628	693	2.4e-27	95.5
LXL04_025320	`PF02140.24`	SUEL_Lectin	753	834	1.4e-13	51.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCU9`	Arabidopsis thaliana	Beta-galactosidase 13	54.444%	Swiss-Prot	strong database homology
`Q9SCU8`	Arabidopsis thaliana	Beta-galactosidase 14	53.911%	Swiss-Prot	strong database homology
`Q9SCV1`	Arabidopsis thaliana	Beta-galactosidase 11	52.664%	Swiss-Prot	strong database homology
`Q6ZJJ0`	Oryza sativa subsp. japonica	Beta-galactosidase 11	51.171%	Swiss-Prot	strong database homology
`Q0IZZ8`	Oryza sativa subsp. japonica	Beta-galactosidase 12	48.689%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card