LXL04_025270 | RubberDandelionOmics

Gene overview

LXL04_025270

Reference: OH-1004 Chr: Chr05 Coordinates: 108964711-108967359 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1795 bp · LXL04_025270|LXL04_025270|OH1004|cDNA

ATGGGCAATACATGCCGTGGATCATTCGGAGGAAAAGGCGTTAAGAGCTTCAATCAACCTGAACATCGTTCCAGTATCATCAAACACGGATCTTGTTCAACCCAAGTTATCAACTCAACGAATCACTTCTCGAAATCGAACCCACAACAAAACAAATTGTTTCACAATTCAAGTCTGCAACCCCAATTTGACGACGCCATGAACCGCCACGGCATTTCTAATCAACCATACTATGTCATTGGACATAAAACCGCAAACAT...

CDS

Download CDS FASTA

1773 bp · LXL04_025270|LXL04_025270|OH1004|CDS

ATGGGCAATACATGCCGTGGATCATTCGGAGGAAAAGGCGTTAAGAGCTTCAATCAACCTGAACATCGTTCCAGTATCATCAAACACGGATCTTGTTCAACCCAAGTTATCAACTCAACGAATCACTTCTCGAAATCGAACCCACAACAAAACAAATTGTTTCACAATTCAAGTCTGCAACCCCAATTTGACGACGCCATGAACCGCCACGGCATTTCTAATCAACCATACTATGTCATTGGACATAAAACCGCAAACAT...

Protein

Download Protein FASTA

590 aa · LXL04_025270|LXL04_025270|OH1004|PROTEIN

MGNTCRGSFGGKGVKSFNQPEHRSSIIKHGSCSTQVINSTNHFSKSNPQQNKLFHNSSLQPQFDDAMNRHGISNQPYYVIGHKTANIRDLYTLGQKLGQGQFGTTYLCTEHSTGTNYACKSISKRKLISKEDVEDVRREIQIMHHLAGHSNIVTIKGAYEDPLYVHIVMELCGGGELFDRIIQRGHYSERKAAELIKIIVGVVQACHSLGVMHRDLKPENFLLVNKDDDFSLKAIDFGLSIFFKPGQIFTDVVGSPYYVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025270`
TK1151 ID	TkA06G070780
OH-1004 ID	LXL04_025270
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 94.656 / OH-1004 84.068 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025270

Location Chr05:108964711-108967359 (-)

Description Similar to CPK4: Calcium-dependent protein kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17290`	May play a role in signal transduction pathways that involve calcium as a second messenger.	CDPKs CPK6 and CPK3 function in ABA regulation of guard cell S-type anion- and Ca(2+)-permeable channels and stomatal closure.2006 · DOI: 10.1371/journal.pbio.0040327 Calcium-dependent protein kinases responsible for the phosphorylation of a bZIP transcription factor FD crucial for the florigen complex formation.2015 · DOI: 10.1038/srep08341
`At4g35310`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At4g38230`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025270 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G17290

ath:AT4G35310

ath:AT4G38230

sot:102594309

sot:102604043

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.452

Rank 1 · LXL04_025270 · OH-1004

Cell membrane0.425

Rank 2 · LXL04_025270 · OH-1004

Nucleus0.234

Rank 3 · LXL04_025270 · OH-1004

Golgi apparatus0.083

Rank 4 · LXL04_025270 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_025270 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase91-349 aa

PF07714.24PK_Tyr_Ser-Thr92-343 aa

PF13833.13EF-hand_8379-418 aa

PF12763.14EH389-457 aa

PF00036.39EF-hand_1397-424 aa

PF13499.13EF-hand_7397-456 aa

PF13405.13EF-hand_6397-425 aa

PF13202.13EF-hand_5397-419 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025270	`PF00069.32`	Pkinase	91	349	7.5e-76	255.7
LXL04_025270	`PF07714.24`	PK_Tyr_Ser-Thr	92	343	2.8e-23	83.3
LXL04_025270	`PF13833.13`	EF-hand_8	379	418	4.8e-18	65.4
LXL04_025270	`PF12763.14`	EH	389	457	5.1e-08	33.5
LXL04_025270	`PF00036.39`	EF-hand_1	397	424	1.2e-33	112.9
LXL04_025270	`PF13499.13`	EF-hand_7	397	456	2.9e-28	98.7
LXL04_025270	`PF13405.13`	EF-hand_6	397	425	5.7e-26	88.4
LXL04_025270	`PF13202.13`	EF-hand_5	397	419	3.9e-24	83.7
LXL04_025270	`PF13833.13`	EF-hand_8	412	456	4.8e-18	65.4
LXL04_025270	`PF00036.39`	EF-hand_1	432	456	1.2e-33	112.9
LXL04_025270	`PF13499.13`	EF-hand_7	466	528	2.9e-28	98.7
LXL04_025270	`PF13405.13`	EF-hand_6	469	493	5.7e-26	88.4
LXL04_025270	`PF13202.13`	EF-hand_5	469	491	3.9e-24	83.7
LXL04_025270	`PF00036.39`	EF-hand_1	470	493	1.2e-33	112.9
LXL04_025270	`PF00036.39`	EF-hand_1	503	529	1.2e-33	112.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38872`	Arabidopsis thaliana	Calcium-dependent protein kinase 6	80.909%	Swiss-Prot	strong database homology
`Q38871`	Arabidopsis thaliana	Calcium-dependent protein kinase 5	80.072%	Swiss-Prot	strong database homology
`Q9SZM3`	Arabidopsis thaliana	Calcium-dependent protein kinase 26	86.100%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card