LXL04_023774 | RubberDandelionOmics

Gene overview

LXL04_023774

Reference: OH-1004 Chr: Chr05 Coordinates: 67941143-67943653 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · LXL04_023774|LXL04_023774|OH1004|cDNA

ATGGAAGATGAATATGCAAAACTTATCAGGCGGATGAATCCACCAAGAGTTACAATTGACAATAGCTCTTCTCCAGATGCAACAGTTATCCAGGTTGAAAGTGTTAACAAGCAAGGTATTCTCCTTGAAGTTGTCCAAGTTCTTTCGGATTTAGATCTCGTCATCACAAAAGCCTACATCTCATCAGATGGGGGATGGTTCATGGACGTATCCGATCCTCTTTCCCTGATTTTGACAGTTTTCAATGTCATTTACCGTGA...

CDS

Download CDS FASTA

1461 bp · LXL04_023774|LXL04_023774|OH1004|CDS

ATGGAAGATGAATATGCAAAACTTATCAGGCGGATGAATCCACCAAGAGTTACAATTGACAATAGCTCTTCTCCAGATGCAACAGTTATCCAGGTTGAAAGTGTTAACAAGCAAGGTATTCTCCTTGAAGTTGTCCAAGTTCTTTCGGATTTAGATCTCGTCATCACAAAAGCCTACATCTCATCAGATGGGGGATGGTTCATGGACGTATCCGATCCTCTTTCCCTGATTTTGACAGTTTTCAATGTCATTTACCGTGA...

Protein

Download Protein FASTA

486 aa · LXL04_023774|LXL04_023774|OH1004|PROTEIN

MEDEYAKLIRRMNPPRVTIDNSSSPDATVIQVESVNKQGILLEVVQVLSDLDLVITKAYISSDGGWFMDVSDPLSLILTVFNVIYRDGSKIKDEGVIDYIKKVSIFSNFHHLPFRNPPLSSTISDTKNSLSLKLHHNLSQVLESDAFYIPPSGSVGLKSSQDYTAIELAGIDRPGLLSEVSAVLTSLGCNVVNAEIWTHNARAAAVVHVTDEKTRCAVEDPKRLSTIKKLLCNVLKGNDNDFKTGKMTLSPPGFTHRERR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023774`
TK1151 ID	TkA06G221120
OH-1004 ID	LXL04_023774
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 99.461 / OH-1004 83.745 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023774

Location Chr05:67941143-67943653 (-)

Description Similar to ACR6: ACT domain-containing protein ACR6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01990`	May bind amino acids.	No verified direct reference in this release
`At1g69040`	May bind amino acids.	No verified direct reference in this release
`At2g03730`	May bind amino acids.	No verified direct reference in this release
`At1g76990`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484
`At1g12420`	May bind amino acids.	Molecular characterization of a novel gene family encoding ACT domain repeat proteins in Arabidopsis.2002 · DOI: 10.1104/pp.007484

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023774 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006521 regulation of amino acid metabolic process Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005829 cytosol Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016597 amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT1G12420

ath:AT1G69040

ath:AT1G76990

ath:AT2G03730

ath:AT3G01990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.425

Rank 1 · LXL04_023774 · OH-1004

Nucleus0.417

Rank 2 · LXL04_023774 · OH-1004

Cell membrane0.143

Rank 3 · LXL04_023774 · OH-1004

Lysosome / Vacuole0.072

Rank 4 · LXL04_023774 · OH-1004

Endoplasmic reticulum0.062

Rank 5 · LXL04_023774 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24931.2ACT_ACR9_3rd17-63 aa

PF26956.1ACT_ACR_D124-103 aa

PF01842.32ACT170-213 aa

PF24931.2ACT_ACR9_3rd291-372 aa

PF01842.32ACT380-442 aa

PF26956.1ACT_ACR_D1381-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023774	`PF24931.2`	ACT_ACR9_3rd	17	63	3.4e-17	63.0
LXL04_023774	`PF26956.1`	ACT_ACR_D1	24	103	1.2e-42	144.4
LXL04_023774	`PF01842.32`	ACT	170	213	6.9e-28	96.8
LXL04_023774	`PF24931.2`	ACT_ACR9_3rd	291	372	3.4e-17	63.0
LXL04_023774	`PF01842.32`	ACT	380	442	6.9e-28	96.8
LXL04_023774	`PF26956.1`	ACT_ACR_D1	381	449	1.2e-42	144.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SGA0`	Arabidopsis thaliana	ACT domain-containing protein ACR6	56.879%	Swiss-Prot	strong database homology
`Q8LJW3`	Arabidopsis thaliana	ACT domain-containing protein ACR4	53.593%	Swiss-Prot	strong database homology
`Q9ZPQ8`	Arabidopsis thaliana	ACT domain-containing protein ACR5	50.206%	Swiss-Prot	strong database homology
`O49285`	Arabidopsis thaliana	ACT domain-containing protein ACR3	46.392%	Swiss-Prot	moderate database homology
`Q9LNA5`	Arabidopsis thaliana	ACT domain-containing protein ACR8	43.833%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card