Gene Card
Gene overview
cDNA / CDS / Protein Sequences
729 bp · LXL04_023345|LXL04_023345|OH1004|cDNA
ATGGAAGAGGCCGATTCGGTGGTCGGCGAGGCTTCGGTGGTCACCGTTTCCCACCGGATGAAGCTTACGACTTCCAATTCAACAAATATTGCTCGGCAAAGATTCGGTAATATGTGCAGGTTTGAGATTGGGAATAGGGATGAAGAAGCACCACTATTTCAGCCGCTAAGGTGGTATAATGAGCTGGTCAACATTCAGGAGCAATCTTGGAATAAAATGGATAAAGATTTGGGTTCTAAGCGGATGACTCGAAGTAGATG...
729 bp · LXL04_023345|LXL04_023345|OH1004|CDS
ATGGAAGAGGCCGATTCGGTGGTCGGCGAGGCTTCGGTGGTCACCGTTTCCCACCGGATGAAGCTTACGACTTCCAATTCAACAAATATTGCTCGGCAAAGATTCGGTAATATGTGCAGGTTTGAGATTGGGAATAGGGATGAAGAAGCACCACTATTTCAGCCGCTAAGGTGGTATAATGAGCTGGTCAACATTCAGGAGCAATCTTGGAATAAAATGGATAAAGATTTGGGTTCTAAGCGGATGACTCGAAGTAGATG...
Protein
Download Protein FASTA242 aa · LXL04_023345|LXL04_023345|OH1004|PROTEIN
MEEADSVVGEASVVTVSHRMKLTTSNSTNIARQRFGNMCRFEIGNRDEEAPLFQPLRWYNELVNIQEQSWNKMDKDLGSKRMTRSRWLHTWNFFNFNFWLLFAAFSMVQNCVDVIGTTDIMEKGTDIVVFRTCEQERNQVGFQMGTSDAVRALKAAELVCKDVADFDNADFDNVKEEFMHTKVNTPQLLTPRARIFTKQTLMNSPTFVLTLSELMQSQSFFSSTPVKATVFPQHLISDLPPL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023345 |
|---|---|
| TK1151 ID | TkA06G360580 |
| OH-1004 ID | LXL04_023345 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 71.200 |
| Protein coverage (%) | TK1151 79.699 / OH-1004 47.934Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023345 |
|---|---|
| Location | Chr05:33965815-33971202 (-) |
| Description | Similar to DUS2: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002943 tRNA dihydrouridine synthesis Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0000049 tRNA binding Molecular Function GO:0003725 double-stranded RNA binding Molecular Function GO:0004860 protein kinase inhibitor activity Molecular Function GO:0010181 FMN binding Molecular Function GO:0017150 tRNA dihydrouridine synthase activity Molecular Function GO:0050660 flavin adenine dinucleotide binding Molecular Function |
| KEGG gene cross-reference | hsa:54920 mmu:66369 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.