TkA06G360580 | RubberDandelionOmics

Gene overview

TkA06G360580

Reference: TK1151 Chr: Chr06 Coordinates: 89402291-89403425 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA06G360580|TK1151|cDNA

ATGAACTCACCAACCTTTGTGTTGACACTTTCAAAACTCATGCAATCTCAGGTAACCAGTAGTGAAGGATCTGCCGGCTATATTGTTGTTTTTAGAACCTGTGAACAAGAAAGAAATCAAGTGGTTTTTCAAATGGGCACTTCAGATGCTGTTAGGGCTTTAAAGGATGCCGAATTAGTGTGTAAAGATGTTGCAGATTTTGACAATGCAGATTTTGACAATGTTAAAGAGGAATTTATGCATACCACATATGTTGGAAT...

CDS

Download CDS FASTA

402 bp · TkA06G360580|TK1151|CDS

ATGAACTCACCAACCTTTGTGTTGACACTTTCAAAACTCATGCAATCTCAGGTAACCAGTAGTGAAGGATCTGCCGGCTATATTGTTGTTTTTAGAACCTGTGAACAAGAAAGAAATCAAGTGGTTTTTCAAATGGGCACTTCAGATGCTGTTAGGGCTTTAAAGGATGCCGAATTAGTGTGTAAAGATGTTGCAGATTTTGACAATGCAGATTTTGACAATGTTAAAGAGGAATTTATGCATACCACATATGTTGGAAT...

Protein

Download Protein FASTA

133 aa · TkA06G360580|TK1151|PROTEIN

MNSPTFVLTLSKLMQSQVTSSEGSAGYIVVFRTCEQERNQVVFQMGTSDAVRALKDAELVCKDVADFDNADFDNVKEEFMHTTYVGIKQMVFGGSEYENWSPSLTSEDQSFFSSTPVKATVFPQHLISDLPPL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G360580`
TK1151 ID	TkA06G360580
OH-1004 ID	LXL04_023345
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	71.200
Protein coverage (%)	TK1151 79.699 / OH-1004 47.934 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G360580`
Location	Chr06:89402291-89403425 (+)
Description	Similar to DUS2: tRNA-dihydrouridine(20) synthase [NAD(P)+]-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023345` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002943 tRNA dihydrouridine synthesis Biological Process GO:0140374 antiviral innate immune response Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0000049 tRNA binding Molecular Function GO:0003725 double-stranded RNA binding Molecular Function GO:0004860 protein kinase inhibitor activity Molecular Function GO:0010181 FMN binding Molecular Function GO:0017150 tRNA dihydrouridine synthase activity Molecular Function GO:0050660 flavin adenine dinucleotide binding Molecular Function
KEGG gene cross-reference	hsa:54920 mmu:66369 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.429

Rank 1 · TkA06G360580 · TK1151

Nucleus0.417

Rank 2 · TkA06G360580 · TK1151

Mitochondrion0.142

Rank 3 · TkA06G360580 · TK1151

Cell membrane0.086

Rank 4 · TkA06G360580 · TK1151

Extracellular0.081

Rank 5 · TkA06G360580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12049DUF353137-51 aa

PF12049DUF353180-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G360580	`PF12049`	DUF3531	37	51	0.016	15.8
TkA06G360580	`PF12049`	DUF3531	80	105	0.016	15.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card