Gene Card
Gene overview
cDNA / CDS / Protein Sequences
420 bp · LXL04_022111|LXL04_022111|OH1004|cDNA
ATGGCACCAAAGGCTGAGAAGAAACCGGCAGAGAAGAAACCAGCGGCGGAGAAGGCTCCGGCAGAGAAGAAACCGAAGGCGGAGAAGAAGCTACCGAAGGACGCATCGGCGACcgacaagaagaagaagaggaacaAGAAATCCGTTGAGACATACAAGATCTACATTTTCAAGGTTCTCAAGCAGGTTCACCCTGATATTGGAATCTCAAGCAAGGCTATGGGGATTATGAATTCGTTCATCAACGATATATTTGAGAA...
420 bp · LXL04_022111|LXL04_022111|OH1004|CDS
ATGGCACCAAAGGCTGAGAAGAAACCGGCAGAGAAGAAACCAGCGGCGGAGAAGGCTCCGGCAGAGAAGAAACCGAAGGCGGAGAAGAAGCTACCGAAGGACGCATCGGCGACCGACAAGAAGAAGAAGAGGAACAAGAAATCCGTTGAGACATACAAGATCTACATTTTCAAGGTTCTCAAGCAGGTTCACCCTGATATTGGAATCTCAAGCAAGGCTATGGGGATTATGAATTCGTTCATCAACGATATATTTGAGAA...
Protein
Download Protein FASTA139 aa · LXL04_022111|LXL04_022111|OH1004|PROTEIN
MAPKAEKKPAEKKPAAEKAPAEKKPKAEKKLPKDASATDKKKKRNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_022111 |
|---|---|
| TK1151 ID | TkA05G445830 |
| OH-1004 ID | LXL04_022111 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 74.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_022111 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:144887884-144888303 (+) | |||||||||
| Description | Similar to H2B-3: Histone H2B.3 (Fragment) | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006325 chromatin organization Biological Process GO:0000786 nucleosome Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005829 cytosol Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:0003677 DNA binding Molecular Function GO:0030527 structural constituent of chromatin Molecular Function GO:0046982 protein heterodimerization activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G37470 ath:AT3G45980 mtr:11417139 mtr:11442767 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00125.31Histone36-115 aaPF26281.1Histone_ABTB69-137 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_022111 | PF00125.31 | Histone | 36 | 115 | 7.3e-21 | 75.1 |
| LXL04_022111 | PF26281.1 | Histone_ABTB | 69 | 137 | 5.5e-07 | 30.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.