LXL04_022100 | RubberDandelionOmics

Gene overview

LXL04_022100

Reference: OH-1004 Chr: Chr04 Coordinates: 144616158-144618483 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_022100|LXL04_022100|OH1004|cDNA

ATGGGATCGCCGGATTCTGGTTATGCTTCGTCAAACGAGGGGGCTCCTGCGGCGAAATCTTTTCCTCACAAGTCACAGGCACTTCCTCCCTCAGATGGTGCAGAGACAACATACCTGAGGTTTCTCGCTTCAAATGCTGAAGCTGGTTCAATTATCGGAAAAGCTGGAACAACAATTTCTGATTTCCAGTCAAGATCCAATGCAAGGATTCAGTTGTCCCGCAACTTTGAGTATTTTCCAGGAACATCTGACAGAGTTAT...

CDS

Download CDS FASTA

1017 bp · LXL04_022100|LXL04_022100|OH1004|CDS

ATGGGATCGCCGGATTCTGGTTATGCTTCGTCAAACGAGGGGGCTCCTGCGGCGAAATCTTTTCCTCACAAGTCACAGGCACTTCCTCCCTCAGATGGTGCAGAGACAACATACCTGAGGTTTCTCGCTTCAAATGCTGAAGCTGGTTCAATTATCGGAAAAGCTGGAACAACAATTTCTGATTTCCAGTCAAGATCCAATGCAAGGATTCAGTTGTCCCGCAACTTTGAGTATTTTCCAGGAACATCTGACAGAGTTAT...

Protein

Download Protein FASTA

338 aa · LXL04_022100|LXL04_022100|OH1004|PROTEIN

MGSPDSGYASSNEGAPAAKSFPHKSQALPPSDGAETTYLRFLASNAEAGSIIGKAGTTISDFQSRSNARIQLSRNFEYFPGTSDRVIMVSGTIDEVLEAVELILTKLLNEFYAEDGDEGEPRSKVRLIVPNSSCGGIIGKGGSMIRSFIEDTGANIKISPQDHNYIGLNDRLVTVIGTLQQLVHAVNLILLKLSEDLYYVQSIGPPFPYAVPYNAPNYGPHGGGGKFQNNNRFQNNKVLYFSLFRRVADEHIGLVVGRGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022100`
TK1151 ID	TkA05G444760
OH-1004 ID	LXL04_022100
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.600
Protein coverage (%)	TK1151 100.000 / OH-1004 70.710 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022100

Location Chr04:144616158-144618483 (+)

Description Similar to BTR1: Protein BTR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04430`	Negative regulator of tomato mosaic virus (ToMV) multiplication, but has no effect on the multiplication of cucumber mosaic virus (CMV).	Identification of an Arabidopsis thaliana protein that binds to tomato mosaic virus genomic RNA and inhibits its multiplication.2008 · DOI: 10.1016/j.virol.2008.07.033

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022100 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000381 regulation of alternative mRNA splicing, via spliceosome Biological Process

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0006396 RNA processing Biological Process

GO:0008380 RNA splicing Biological Process

GO:0033120 positive regulation of RNA splicing Biological Process

GO:0046719 regulation by virus of viral protein levels in host cell Biological Process

GO:0050684 regulation of mRNA processing Biological Process

GO:0051252 regulation of RNA metabolic process Biological Process

GO:0120163 negative regulation of cold-induced thermogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

KEGG gene cross-reference

ath:AT5G04430

dme:Dmel_CG42670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.662

Rank 1 · LXL04_022100 · OH-1004

Nucleus0.488

Rank 2 · LXL04_022100 · OH-1004

Cell membrane0.063

Rank 3 · LXL04_022100 · OH-1004

Lysosome / Vacuole0.036

Rank 4 · LXL04_022100 · OH-1004

Mitochondrion0.028

Rank 5 · LXL04_022100 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00013.36KH_140-104 aa

PF00013.36KH_1125-190 aa

PF00013.36KH_1247-308 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022100	`PF00013.36`	KH_1	40	104	5.7e-46	154.8
LXL04_022100	`PF00013.36`	KH_1	125	190	5.7e-46	154.8
LXL04_022100	`PF00013.36`	KH_1	247	308	5.7e-46	154.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ82`	Arabidopsis thaliana	Protein BTR1	57.911%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card