LXL04_018014 | RubberDandelionOmics

Gene overview

LXL04_018014

Reference: OH-1004 Chr: Chr04 Coordinates: 5109539-5111503 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · LXL04_018014|LXL04_018014|OH1004|cDNA

ATGGCTGATTTTACAACTTCTACTCACCGAGCCAAGTGGATCTTCACTCCCCAAGATTTGGTACACAACCTTCTCATTTCATATACCATTTTGAAACTCTTTCTACCAATTAAACTTTCTTTGAATAATGCTTTCCAGAAAGATAAATACAAGGCTGCTAATCATAGAGCAAAACAGATGCTGGAGAAGTATGGATCAACAAGGGTGGATGTCGATCTTGATGGCACCTTGTCTTATCCAGAGGTTCCAACTGACCCAAA...

CDS

Download CDS FASTA

1038 bp · LXL04_018014|LXL04_018014|OH1004|CDS

ATGGCTGATTTTACAACTTCTACTCACCGAGCCAAGTGGATCTTCACTCCCCAAGATTTGGTACACAACCTTCTCATTTCATATACCATTTTGAAACTCTTTCTACCAATTAAACTTTCTTTGAATAATGCTTTCCAGAAAGATAAATACAAGGCTGCTAATCATAGAGCAAAACAGATGCTGGAGAAGTATGGATCAACAAGGGTGGATGTCGATCTTGATGGCACCTTGTCTTATCCAGAGGTTCCAACTGACCCAAA...

Protein

Download Protein FASTA

345 aa · LXL04_018014|LXL04_018014|OH1004|PROTEIN

MADFTTSTHRAKWIFTPQDLVHNLLISYTILKLFLPIKLSLNNAFQKDKYKAANHRAKQMLEKYGSTRVDVDLDGTLSYPEVPTDPKDNGEKHSRSKPLKIDEEQLLRAFYEFKIQDVCDAFKFPRKIQATALIYFKRFYLQWSVMEHHPKDIMLTCIYTACKAEENHVSAEELGKGIDQDHQVILNNEMVVLQSLGFDLIVYSPYRSIDGFIDDMEDFVYSNNGQLQLLKDLHETAKMVADKMMRSEAPLLFSPGQLAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_018014`
TK1151 ID	TkA03G048600
OH-1004 ID	LXL04_018014
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 96.216 / OH-1004 51.594 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_018014

Location Chr04:5109539-5111503 (+)

Description Similar to CYCH1-1: Cyclin-H1-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27620`	Associates with CDK-2 and CDK-3 and activates the CDK kinases.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0737600`	Involved in cell cycle regulation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018014 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009637 response to blue light Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0050821 protein stabilization Biological Process

GO:0051301 cell division Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:1990069 stomatal opening Biological Process

GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

KEGG gene cross-reference

ath:AT5G27620

dosa:Os03g0737600

mmu:66671

rno:84389

xla:394356

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.830

Rank 1 · LXL04_018014 · OH-1004

Cytoplasm0.258

Rank 2 · LXL04_018014 · OH-1004

Mitochondrion0.031

Rank 3 · LXL04_018014 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_018014 · OH-1004

Endoplasmic reticulum0.018

Rank 5 · LXL04_018014 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00134.29Cyclin_N108-200 aa

PF00382.25TFIIB114-174 aa

PF16899.11Cyclin_C_2205-306 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_018014	`PF00134.29`	Cyclin_N	108	200	4.6e-11	43.2
LXL04_018014	`PF00382.25`	TFIIB	114	174	6e-08	33.3
LXL04_018014	`PF16899.11`	Cyclin_C_2	205	306	1.4e-11	45.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W5S1`	Arabidopsis thaliana	Cyclin-H1-1	55.362%	Swiss-Prot	strong database homology
`Q10D80`	Oryza sativa subsp. japonica	Cyclin-H1-1	57.612%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card