Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2154 bp · TkA03G048600|TK1151|cDNA
TTAGCCTCCAGCTTTACCCTTTTCACGCCATTACTCCCTACCAGCCATCGATTCCTCGATTCCTGTACGAGTCATTACTGCCCTCGATACTCCTTCACCAGCCCTCGATACTCCTTCACCAGCCCTCGATGGCTGTCAAGATTGAAATCGGTGTTGCTTCCAGTCGGTGTTTGCTTCCAATCAGCTTCCAATAAGCTTCCAATCGGTGTTTGCTTCCAATCGGTGTTGCAACCTGTGAAATTAACAGATGAAGATGAAGT...
558 bp · TkA03G048600|TK1151|CDS
ATGGAACATCATCCAAAAGACATCATGTTGACTTGCATATATACGGCATGTAAAGCTGAAGAAAATCATGTGTCAGCTGAAGAGCTTGGTAAGGGGATTGATCAAGATCATCAAGTCATTCTCAATAATGAGATGGTTGTTCTTCAGTCTCTTGGATTTGATCTTATTGTCTATTCGCCCTACCGCTCAATTGACGGTTTTATCGATGATATGGAGGACTTTGTCTATTCAAATAATGGTCAACTTCAACTACTAAAGGA...
Protein
Download Protein FASTA185 aa · TkA03G048600|TK1151|PROTEIN
MEHHPKDIMLTCIYTACKAEENHVSAEELGKGIDQDHQVILNNEMVVLQSLGFDLIVYSPYRSIDGFIDDMEDFVYSNNGQLQLLKDLHETAKMVADKMMRSEAPLLFSPGQLALAALRRSNEEYQVLDFERYLNNTLSRQHPVRTVSELTAYLNAIDQLVNSLVTPTAADMKHIDRKPFDDTYP
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G048600 |
|---|---|
| TK1151 ID | TkA03G048600 |
| OH-1004 ID | LXL04_018014 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 96.216 / OH-1004 51.594Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G048600 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:12800139-12804299 (-) | ||||||||||||
| Description | Similar to CYCH1-1: Cyclin-H1-1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0006367 transcription initiation at RNA polymerase II promoter Biological Process GO:0009414 response to water deprivation Biological Process GO:0009637 response to blue light Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0050821 protein stabilization Biological Process GO:0051301 cell division Biological Process GO:0072593 reactive oxygen species metabolic process Biological Process GO:1990069 stomatal opening Biological Process GO:2000045 regulation of G1/S transition of mitotic cell cycle Biological Process GO:2000070 regulation of response to water deprivation Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT5G27620 dosa:Os03g0737600 mmu:66671 rno:84389 xla:394356 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF16899Cyclin_C_24-36 aaPF00134Cyclin_N5-55 aaPF00382TFIIB5-29 aaPF29928BUR2_N7-26 aaPF05763DUF83517-85 aaPF16899Cyclin_C_260-161 aaPF29928BUR2_N61-107 aaPF00382TFIIB80-102 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G048600 | PF16899 | Cyclin_C_2 | 4 | 36 | 4.7e-11 | 43.7 |
| TkA03G048600 | PF00134 | Cyclin_N | 5 | 55 | 0.0005 | 20.5 |
| TkA03G048600 | PF00382 | TFIIB | 5 | 29 | 0.072 | 13.8 |
| TkA03G048600 | PF29928 | BUR2_N | 7 | 26 | 0.062 | 14.1 |
| TkA03G048600 | PF05763 | DUF835 | 17 | 85 | 0.0075 | 16.8 |
| TkA03G048600 | PF16899 | Cyclin_C_2 | 60 | 161 | 4.7e-11 | 43.7 |
| TkA03G048600 | PF29928 | BUR2_N | 61 | 107 | 0.062 | 14.1 |
| TkA03G048600 | PF00382 | TFIIB | 80 | 102 | 0.072 | 13.8 |
| TkA03G048600 | PF00134 | Cyclin_N | 121 | 138 | 0.0005 | 20.5 |
| TkA03G048600 | PF28028 | Amuc_1100 | 127 | 181 | 0.0098 | 16.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.