LXL04_017512 | RubberDandelionOmics

Gene overview

LXL04_017512

Reference: OH-1004 Chr: Chr03 Coordinates: 152320415-152321086 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

573 bp · LXL04_017512|LXL04_017512|OH1004|cDNA

ATGGCAGATATACGTGATCAAGACGGCAACCCTATTCAACTCACCGACGACCTCGGCCGCCCAGTTCAACTCACCGACGAGTTCGGCCGTCCCATTCACCTTACCGGTGTCGCCACCACCGAAGACTCAGCCCTGCATGAAGGAACTACAGCTATCGGTTCCGACCATAAGATTCATGATGGAACACACTTTTCTCCGGTGGCTGGTGTCGCCGGAGGTGAAAAACCGGTACCCGGTGTCGCCGAAAGTGAAAATCAGCA...

CDS

Download CDS FASTA

573 bp · LXL04_017512|LXL04_017512|OH1004|CDS

ATGGCAGATATACGTGATCAAGACGGCAACCCTATTCAACTCACCGACGACCTCGGCCGCCCAGTTCAACTCACCGACGAGTTCGGCCGTCCCATTCACCTTACCGGTGTCGCCACCACCGAAGACTCAGCCCTGCATGAAGGAACTACAGCTATCGGTTCCGACCATAAGATTCATGATGGAACACACTTTTCTCCGGTGGCTGGTGTCGCCGGAGGTGAAAAACCGGTACCCGGTGTCGCCGAAAGTGAAAATCAGCA...

Protein

Download Protein FASTA

190 aa · LXL04_017512|LXL04_017512|OH1004|PROTEIN

MADIRDQDGNPIQLTDDLGRPVQLTDEFGRPIHLTGVATTEDSALHEGTTAIGSDHKIHDGTHFSPVAGVAGGEKPVPGVAESENQQVGESRSSSSSSQSEDDGQGGRKKKKKKGLMQKIKEKLPGHKSKQEKTPEMVYTATTKISVTTPAGPLGEPKTEFIKVEHQEEEHEKKGLMDKIMDKLPGHHSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017512`
TK1151 ID	TkA02G037280
OH-1004 ID	LXL04_017512
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017512

Location Chr03:152320415-152321086 (+)

Description Similar to Late embryogenesis abundant protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21490`	Probable dehydrin LEA.	No verified direct reference in this release
`At5g66400`	Dehydrin Rab18.	No verified direct reference in this release
`At3g50980`	Dehydrin Xero 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017512 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G21490

ath:AT3G50980

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · LXL04_017512 · OH-1004

Cell membrane0.412

Rank 2 · LXL04_017512 · OH-1004

Nucleus0.263

Rank 3 · LXL04_017512 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_017512 · OH-1004

Golgi apparatus0.032

Rank 5 · LXL04_017512 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257.25Dehydrin22-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017512	`PF00257.25`	Dehydrin	22	188	4.1e-36	125.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96261`	Arabidopsis thaliana	Probable dehydrin LEA	38.647%	Swiss-Prot	moderate database homology
`P30185`	Arabidopsis thaliana	Dehydrin Rab18	45.349%	Swiss-Prot	weak database homology
`P25863`	Arabidopsis thaliana	Dehydrin Xero 1	41.085%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card