TkA02G037280 | RubberDandelionOmics

Gene overview

TkA02G037280

Reference: TK1151 Chr: Chr02 Coordinates: 9368085-9368753 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

537 bp · TkA02G037280|TK1151|cDNA

ATGGCAGATATACGTGATCAAGACGGCAACCCTATTCAACTCACCGACGACCTCGGCCGCCCAGTTCAACTCACCGACGAGTTCGGCCGTCCCATTCACCTTACCGGTGTCGCCACCACCGAAGACTCAGCCCTGCATGAAGGAACTACAGCTATCGGTTCCGACCATAAGATTCATGATGGAACACACTTTTCTCCGGTGGCTGGTGTCGCCGGAGGTGAAAAACCGGTACCCGGTGTCGCCGAAAGTGAAAATCAGCA...

CDS

Download CDS FASTA

537 bp · TkA02G037280|TK1151|CDS

ATGGCAGATATACGTGATCAAGACGGCAACCCTATTCAACTCACCGACGACCTCGGCCGCCCAGTTCAACTCACCGACGAGTTCGGCCGTCCCATTCACCTTACCGGTGTCGCCACCACCGAAGACTCAGCCCTGCATGAAGGAACTACAGCTATCGGTTCCGACCATAAGATTCATGATGGAACACACTTTTCTCCGGTGGCTGGTGTCGCCGGAGGTGAAAAACCGGTACCCGGTGTCGCCGAAAGTGAAAATCAGCA...

Protein

Download Protein FASTA

178 aa · TkA02G037280|TK1151|PROTEIN

MADIRDQDGNPIQLTDDLGRPVQLTDEFGRPIHLTGVATTEDSALHEGTTAIGSDHKIHDGTHFSPVAGVAGGEKPVPGVAESENQQVGESRSSSSSSSEDDGQGGRKKKKKGLMQKIKEKLPGHKSKQEKTPEMVYTATTKISVTTPAGPLEHQEEEHEKKGLMDKIMDKLPGHHSH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G037280`
TK1151 ID	TkA02G037280
OH-1004 ID	LXL04_017512
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	85.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G037280`
Location	Chr02:9368085-9368753 (-)
Description	Similar to Late embryogenesis abundant protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_017512` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009737 response to abscisic acid Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ath:AT2G21490 ath:AT3G50980 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · TkA02G037280 · TK1151

Cell membrane0.402

Rank 2 · TkA02G037280 · TK1151

Nucleus0.270

Rank 3 · TkA02G037280 · TK1151

Mitochondrion0.039

Rank 4 · TkA02G037280 · TK1151

Golgi apparatus0.032

Rank 5 · TkA02G037280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00257Dehydrin5-16 aa

PF03527RHS6-19 aa

PF03527RHS15-30 aa

PF00257Dehydrin22-176 aa

PF21549PRDM2_PR41-70 aa

PF15794CCDC10685-137 aa

PF10500SR-2590-157 aa

PF11983FtsA_C105-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G037280	`PF00257`	Dehydrin	5	16	1.1e-38	133.8
TkA02G037280	`PF03527`	RHS	6	19	0.21	12.2
TkA02G037280	`PF03527`	RHS	15	30	0.21	12.2
TkA02G037280	`PF00257`	Dehydrin	22	176	1.1e-38	133.8
TkA02G037280	`PF21549`	PRDM2_PR	41	70	0.17	12.3
TkA02G037280	`PF15794`	CCDC106	85	137	0.055	13.9
TkA02G037280	`PF10500`	SR-25	90	157	0.0032	17.8
TkA02G037280	`PF11983`	FtsA_C	105	119	1.3	10.8
TkA02G037280	`PF11983`	FtsA_C	119	168	1.3	10.8
TkA02G037280	`PF21549`	PRDM2_PR	126	162	0.17	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card