LXL04_013455 | RubberDandelionOmics

Gene overview

LXL04_013455

Reference: OH-1004 Chr: Chr03 Coordinates: 29891627-29893454 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_013455|LXL04_013455|OH1004|cDNA

ATGGAGAAGAAAAGAGTGGATGAGAGCGTGCAAGTGCCAGCTCCAGGAAGAGTAGACAGATTCGGATTTGCAAAACAGGAACATAACTCGCCTGATGGCATATCCAAAAGCAAGTCGGCATTAGAGTATCAGAGGGAACAGAAAAGACTTAGAAAATGGAGAAAGATGATTGGTGTTGGAGGTAGCGATTGGAAGCATTATGTAAGAAGGAAACCAAACGTGGTCAAACGACGTATACGGAAAGGAATCCCTGATTCTTT...

CDS

Download CDS FASTA

1077 bp · LXL04_013455|LXL04_013455|OH1004|CDS

ATGGAGAAGAAAAGAGTGGATGAGAGCGTGCAAGTGCCAGCTCCAGGAAGAGTAGACAGATTCGGATTTGCAAAACAGGAACATAACTCGCCTGATGGCATATCCAAAAGCAAGTCGGCATTAGAGTATCAGAGGGAACAGAAAAGACTTAGAAAATGGAGAAAGATGATTGGTGTTGGAGGTAGCGATTGGAAGCATTATGTAAGAAGGAAACCAAACGTGGTCAAACGACGTATACGGAAAGGAATCCCTGATTCTTT...

Protein

Download Protein FASTA

358 aa · LXL04_013455|LXL04_013455|OH1004|PROTEIN

MEKKRVDESVQVPAPGRVDRFGFAKQEHNSPDGISKSKSALEYQREQKRLRKWRKMIGVGGSDWKHYVRRKPNVVKRRIRKGIPDSLRGLVWQLISGSRDLLLMNPGVYEQLVIYETSASELDIIRDIGRTFPSHVFYQQRHGPGQRSLYNVLKAYSVYDREVGYVQGMGYLAGLLLLYMSEEDAFWLVVALLKGAVHAPMEGLYLEGLPLVQQYLFQFDRLMREYMPKLGEHFTEEMINPSMYGSQWFITVFSYSFPFH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_013455`
TK1151 ID	TkA02G495050
OH-1004 ID	LXL04_013455
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_013455`
Location	Chr03:29891627-29893454 (-)
Description	Similar to EVI5L: EVI5-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013455` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006897 endocytosis Biological Process GO:0015031 protein transport Biological Process GO:0030334 regulation of cell migration Biological Process GO:0032880 regulation of protein localization Biological Process GO:0042147 retrograde transport, endosome to Golgi Biological Process GO:0043547 positive regulation of GTPase activity Biological Process GO:0051301 cell division Biological Process GO:1902018 negative regulation of cilium assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component GO:0005769 early endosome Cellular Component
KEGG gene cross-reference	dme:Dmel_CG11727 gga:424438 hsa:115704 hsa:7813 mmu:227800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.624

Rank 1 · LXL04_013455 · OH-1004

Nucleus0.219

Rank 2 · LXL04_013455 · OH-1004

Cell membrane0.208

Rank 3 · LXL04_013455 · OH-1004

Golgi apparatus0.156

Rank 4 · LXL04_013455 · OH-1004

Lysosome / Vacuole0.105

Rank 5 · LXL04_013455 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00566.26RabGAP-TBC85-292 aa

PF23436.2RabGap-TBC_2147-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_013455	`PF00566.26`	RabGAP-TBC	85	292	3.3e-60	204.1
LXL04_013455	`PF23436.2`	RabGap-TBC_2	147	305	1.1e-44	153.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card