Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1372 bp · LXL04_005922|LXL04_005922|OH1004|cDNA
ATGACGACGATGAAGGAAAGTAGAGATCGCGGATTCCTTTTACAAATCGCAAGTGTCGCAACCGTCAACTTGAAGACGGCGAAAGGAAGGGCAGAGAGCATCAGCCATGGCAGCTCGCAAGAGAGGAGCTTCAAAACAACCACCGCCACCCACCGAATCACATCCTAAATCCTCGGAACCCGTCGCTACTTCTACAGACCCACAGATCACTCCTTCGAAGCCAAGCAAAATCTTCTTATTCTCTTTGATTTTCTTTCTTC...
1266 bp · LXL04_005922|LXL04_005922|OH1004|CDS
ATGGCAGCTCGCAAGAGAGGAGCTTCAAAACAACCACCGCCACCCACCGAATCACATCCTAAATCCTCGGAACCCGTCGCTACTTCTACAGACCCACAGATCACTCCTTCGAAGCCAAGCAAAATCTTCTTATTCTCTTTGATTTTCTTTCTTCCCTACCTTTACCTGATATTTTATCACTATACAATCGAAACTGAGCTCAAAAAATCGATCCTTATCAATGCATCACTCAGCTTCGCCGGATTCTTTATAACCCTAAT...
Protein
Download Protein FASTA421 aa · LXL04_005922|LXL04_005922|OH1004|PROTEIN
MAARKRGASKQPPPPTESHPKSSEPVATSTDPQITPSKPSKIFLFSLIFFLPYLYLIFYHYTIETELKKSILINASLSFAGFFITLMMIPVASRYVLKRNLFGYDINKKGTPQGLIKVPESLGIVVGIVFLVVAILFQYFNFTADSIWLVEYNAALASVCFMILLGFVDDVLDIPWRVKLLLPSIAALPLLMAYAGHTTIMIPKPLVQYIGTEILDLGWIYKLYMGLLAVFCTNSINIHAGINGLEVGQTVVIAFAILIH...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_005922 |
|---|---|
| TK1151 ID | TkA01G007110 |
| OH-1004 ID | LXL04_005922 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_005922 |
|---|---|
| Location | Chr01:175758927-175762225 (-) |
| Description | Similar to alg7: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006487 protein N-linked glycosylation Biological Process GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0043231 intracellular membrane-bounded organelle Cellular Component GO:0003975 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity Molecular Function GO:0003976 UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity Molecular Function GO:0016757 glycosyltransferase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0046872 metal ion binding Molecular Function |
| KEGG gene cross-reference | bta:537812 cge:100689054 hsa:1798 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00953.27Glycos_transf_4155-325 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_005922 | PF00953.27 | Glycos_transf_4 | 155 | 325 | 3.6e-29 | 102.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.