TkA01G007110 | RubberDandelionOmics

Gene overview

TkA01G007110

Reference: TK1151 Chr: Chr01 Coordinates: 1840820-1844264 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1603 bp · TkA01G007110|TK1151|cDNA

CTGGATCCAACGTGTAAATATGTTATTGGATCCTACAACCCCGATGACGACGATGAAGGAAAGTAGAGATCGGGATTCCTTTTACAAATCGCAACCGTCAACTTGAAGACGGCGAAAGGAAGGGCAGAGAGCATCAGCCATGGCAGCTCGCAAGAGAGGAGCTTCAAAACAACCACCGCCACCCACCGAATCACATCCTAAATCCTCGGAACCCGTCGCTACTTCTACAGACCCACAGATCACTCCTTCAAAGCCAAGCA...

CDS

Download CDS FASTA

1266 bp · TkA01G007110|TK1151|CDS

ATGGCAGCTCGCAAGAGAGGAGCTTCAAAACAACCACCGCCACCCACCGAATCACATCCTAAATCCTCGGAACCCGTCGCTACTTCTACAGACCCACAGATCACTCCTTCAAAGCCAAGCAAAATCCTCTTATTCTCTTTGATTTTCTTTCTCCCCTACCTTTACCTGATATTTTATCACTATACAATCGAAACAGAGCTCAAAAAATCGATCCTTATCAATGCATCACTCAGCTTCGCCGGATTCTTTATAACCCTAAT...

Protein

Download Protein FASTA

421 aa · TkA01G007110|TK1151|PROTEIN

MAARKRGASKQPPPPTESHPKSSEPVATSTDPQITPSKPSKILLFSLIFFLPYLYLIFYHYTIETELKKSILINASLSFAGFFITLMMIPVASRYVLKRNLFGYDINKKGTPQGLVKVPESLGIVVGIVFLVVAILFQYFNFTADSIWLVEYNAALASVCFMILLGFVDDVLDIPWRVKLLLPSIAALPLLMAYAGHTTIMIPKPLVQYIGTEILDLGWIYKLYMGLLAVFCTNSINIHAGINGLEVGQTVVIAFAILIH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G007110`
TK1151 ID	TkA01G007110
OH-1004 ID	LXL04_005922
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G007110`
Location	Chr01:1840820-1844264 (+)
Description	Similar to alg7: UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005922` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006487 protein N-linked glycosylation Biological Process GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0016020 membrane Cellular Component GO:0043231 intracellular membrane-bounded organelle Cellular Component GO:0003975 UDP-N-acetylglucosamine-dolichyl-phosphate N-acetylglucosaminephosphotransferase activity Molecular Function GO:0003976 UDP-N-acetylglucosamine-lysosomal-enzyme N-acetylglucosaminephosphotransferase activity Molecular Function GO:0016757 glycosyltransferase activity Molecular Function GO:0042802 identical protein binding Molecular Function GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	bta:537812 cge:100689054 hsa:1798 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.463

Rank 1 · TkA01G007110 · TK1151

Golgi apparatus0.338

Rank 2 · TkA01G007110 · TK1151

Lysosome / Vacuole0.095

Rank 3 · TkA01G007110 · TK1151

Cytoplasm0.079

Rank 4 · TkA01G007110 · TK1151

Nucleus0.061

Rank 5 · TkA01G007110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08690GET29-100 aa

PF31053DUF879220-86 aa

PF06324Pigment_DH72-78 aa

PF00953Glycos_transf_4105-143 aa

PF05767Pox_A14124-163 aa

PF00953Glycos_transf_4155-325 aa

PF31053DUF8792241-327 aa

PF06324Pigment_DH339-347 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G007110	`PF08690`	GET2	9	100	0.11	12.9
TkA01G007110	`PF31053`	DUF8792	20	86	6.0	7.6
TkA01G007110	`PF06324`	Pigment_DH	72	78	1.2	10.1
TkA01G007110	`PF00953`	Glycos_transf_4	105	143	3.6e-29	102.5
TkA01G007110	`PF05767`	Pox_A14	124	163	0.52	11.2
TkA01G007110	`PF00953`	Glycos_transf_4	155	325	3.6e-29	102.5
TkA01G007110	`PF31053`	DUF8792	241	327	6.0	7.6
TkA01G007110	`PF06324`	Pigment_DH	339	347	1.2	10.1
TkA01G007110	`PF05767`	Pox_A14	394	401	0.52	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card