LXL04_004772 | RubberDandelionOmics

Gene overview

LXL04_004772

Reference: OH-1004 Chr: Chr01 Coordinates: 145744809-145754154 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2127 bp · LXL04_004772|LXL04_004772|OH1004|cDNA

ATGGTTAAAACAGCAGCTGTAGAACCAACAGCCTTGACAATGCCAGGTGGACCAATGGTGACTAGATCTTCGAGCGACTCTACCTTGTCTAAAGCCATGAGATCTTCTTGGGCAGACTCTGTTGACAATACAGCTTCAGGCTCCGACAACAATGGAGCTCCGGGAGCTGGCGGTAAGCCCGCTTATGTTCCACCTCATCTCCGGAACAGGCCACCTGCATCTAGCCAGGCGGCAGCCTCAGCCACAACACATAATGGTGC...

CDS

Download CDS FASTA

2127 bp · LXL04_004772|LXL04_004772|OH1004|CDS

ATGGTTAAAACAGCAGCTGTAGAACCAACAGCCTTGACAATGCCAGGTGGACCAATGGTGACTAGATCTTCGAGCGACTCTACCTTGTCTAAAGCCATGAGATCTTCTTGGGCAGACTCTGTTGACAATACAGCTTCAGGCTCCGACAACAATGGAGCTCCGGGAGCTGGCGGTAAGCCCGCTTATGTTCCACCTCATCTCCGGAACAGGCCACCTGCATCTAGCCAGGCGGCAGCCTCAGCCACAACACATAATGGTGC...

Protein

Download Protein FASTA

708 aa · LXL04_004772|LXL04_004772|OH1004|PROTEIN

MVKTAAVEPTALTMPGGPMVTRSSSDSTLSKAMRSSWADSVDNTASGSDNNGAPGAGGKPAYVPPHLRNRPPASSQAAASATTHNGAPPTNDRLGYSGQTSGSRWTAPMQDYSRPAYSTGGRGGGGGGGWGNRGGGWGGRDMEANPFGNDDIDGVEEIKTEQENNGINFDAYEDIPVETSGENVPPPVNTFAEIDLGEALNLNIRRCKYVKPTPVQRYTIPISLAGRDLMACAQTGSGKTAAFCFPIISGIMRGQFAQRP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004772`
TK1151 ID	TkA01G112910
OH-1004 ID	LXL04_004772
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 90.705 / OH-1004 79.944 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004772

Location Chr01:145744809-145754154 (+)

Description Similar to RH37: DEAD-box ATP-dependent RNA helicase 37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42520`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release
`At3g58570`	DEAD-box ATP-dependent RNA helicase 52.	No verified direct reference in this release
`At3g58510`	DEAD-box ATP-dependent RNA helicase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0805200`	DEAD-box ATP-dependent RNA helicase 37.	No verified direct reference in this release
`Os07g0202100`	DEAD-box ATP-dependent RNA helicase 52B.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004772 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003724 RNA helicase activity Molecular Function

GO:0003729 mRNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT2G42520

ath:AT3G58510

ath:AT3G58570

dosa:Os03g0805200

dosa:Os07g0202100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.614

Rank 1 · LXL04_004772 · OH-1004

Nucleus0.501

Rank 2 · LXL04_004772 · OH-1004

Endoplasmic reticulum0.076

Rank 3 · LXL04_004772 · OH-1004

Cell membrane0.061

Rank 4 · LXL04_004772 · OH-1004

Mitochondrion0.054

Rank 5 · LXL04_004772 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270.36DEAD213-392 aa

PF00271.38Helicase_C428-542 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004772	`PF00270.36`	DEAD	213	392	9.2e-49	166.1
LXL04_004772	`PF00271.38`	Helicase_C	428	542	6.4e-35	120.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84W89`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 37	74.422%	Swiss-Prot	strong database homology
`Q9M2F9`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 52	74.010%	Swiss-Prot	strong database homology
`Q8LA13`	Arabidopsis thaliana	DEAD-box ATP-dependent RNA helicase 11	72.402%	Swiss-Prot	strong database homology
`Q75HJ0`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 37	69.193%	Swiss-Prot	strong database homology
`Q6Z4K6`	Oryza sativa subsp. japonica	DEAD-box ATP-dependent RNA helicase 52B	68.739%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card