LXL04_001167 | RubberDandelionOmics

Gene overview

LXL04_001167

Reference: OH-1004 Chr: Chr01 Coordinates: 21389679-21390694 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_001167|LXL04_001167|OH1004|cDNA

ATGAAAGCGATGACCTCAAAATATGTGTTGTTTTTGGCAATGATTACATTacttgttgttgttgttgtttcgGCAGATAGTAGTTATGGAAAAACACAGGTCGAAGGATTGTTGCCACCAAAAGATGAACATGGCGCTTACAAAAAGAGCGAGCCTAAgataccaacaacaacaacaaagCCCGTGATACCAACAAAAGAGGAACATGGAGGCTACAAAAAGAGCAATCCTAAGATACCAACAAAGCCAATGATACCAAA...

CDS

Download CDS FASTA

939 bp · LXL04_001167|LXL04_001167|OH1004|CDS

ATGAAAGCGATGACCTCAAAATATGTGTTGTTTTTGGCAATGATTACATTACTTGTTGTTGTTGTTGTTTCGGCAGATAGTAGTTATGGAAAAACACAGGTCGAAGGATTGTTGCCACCAAAAGATGAACATGGCGCTTACAAAAAGAGCGAGCCTAAGATACCAACAACAACAACAAAGCCCGTGATACCAACAAAAGAGGAACATGGAGGCTACAAAAAGAGCAATCCTAAGATACCAACAAAGCCAATGATACCAAA...

Protein

Download Protein FASTA

312 aa · LXL04_001167|LXL04_001167|OH1004|PROTEIN

MKAMTSKYVLFLAMITLLVVVVVSADSSYGKTQVEGLLPPKDEHGAYKKSEPKIPTTTTKPVIPTKEEHGGYKKSNPKIPTKPMIPKEEYGKSKKPKIPAAKPVIPKLDHEKSSPKIPMIPKEEHGGYKKENPKTPTKPVIPKEEHRLSPKIPTEPVIPKEEHGANGKPVVPKVAEHPNNIAVQGLIYCKYGSKLIPLKGATVRVTCLGVHKNGHESAPFSFSSCPADVKGYFLAKIASSELLKQDLWEVKECKSFLENS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001167`
TK1151 ID	TkA01G556900
OH-1004 ID	LXL04_001167
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	78.300
Protein coverage (%)	TK1151 100.000 / OH-1004 95.833 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001167

Location Chr01:21389679-21390694 (-)

Description Similar to SRPP: Protein SEED AND ROOT HAIR PROTECTIVE PROTEIN

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02270`	Contributes to cell wall structure in root hairs and seeds, especially in phosphate (Pi) deprivation conditions or in the presence of ethylene.	SRPP, a Cell Wall Protein is Involved in Development and Protection of Seeds and Root Hairs in Arabidopsis thaliana.2017 · DOI: 10.1093/pcp/pcx008 Enhancement of cell wall protein SRPP expression during emergent root hair development in Arabidopsis.2017 · DOI: 10.1080/15592324.2017.1368940 A cell-wall protein SRPP provides physiological integrity to the Arabidopsis seed.2019 · DOI: 10.1007/s10265-018-01083-6
`At3g62680`	May contribute to cell wall structure in root hairs.	Expression of AtPRP3, a proline-rich structural cell wall protein from Arabidopsis, is regulated by cell-type-specific developmental pathways involved in root hair formation.2000 · DOI: 10.1104/pp.122.3.705
`At1g54970`	May contribute to cell wall structure in root hairs.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001167 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010054 trichoblast differentiation Biological Process

GO:0010286 heat acclimation Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0048316 seed development Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

GO:0071369 cellular response to ethylene stimulus Biological Process

GO:0072732 cellular response to calcium ion starvation Biological Process

GO:0080147 root hair cell development Biological Process

KEGG gene cross-reference

ath:AT1G54970

ath:AT3G62680

ath:AT4G02270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.634

Rank 1 · LXL04_001167 · OH-1004

Endoplasmic reticulum0.161

Rank 2 · LXL04_001167 · OH-1004

Cell membrane0.128

Rank 3 · LXL04_001167 · OH-1004

Cytoplasm0.099

Rank 4 · LXL04_001167 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_001167 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81417`	Arabidopsis thaliana	Protein SEED AND ROOT HAIR PROTECTIVE PROTEIN	40.800%	Swiss-Prot	weak database homology
`Q9LZJ7`	Arabidopsis thaliana	Proline-rich protein 3	32.051%	Swiss-Prot	weak database homology
`Q9FZ35`	Arabidopsis thaliana	Proline-rich protein 1	30.435%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card