LXL04_038484 | RubberDandelionOmics

Gene overview

LXL04_038484

Reference: OH-1004 Chr: Chr09 Coordinates: 42264015-42264964 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · LXL04_038484|LXL04_038484|OH1004|cDNA

ATGGGGTCAGCTTATGCTTTAGCCgaaattgatatatatatttcatTCTCACAGATTGGTATAGTGAAGAATTCAGTTGACCAAGCGTTGAGCTGCATTGACCAATGGATGTCCCCAAAGAAGGGTTGGCTACCTCTACTTTTCTTCCCAGCAAGTAGAACAATGTTACCTGAACCACTTGGTGTAGTCCTCATTCTTGGTTCATGGAACTTCCCCATTTCATTGATTTTGGACCCTTTGATTGGGGCAATATCTGCTGG...

CDS

Download CDS FASTA

549 bp · LXL04_038484|LXL04_038484|OH1004|CDS

ATGGGGTCAGCTTATGCTTTAGCCGAAATTGATATATATATTTCATTCTCACAGATTGGTATAGTGAAGAATTCAGTTGACCAAGCGTTGAGCTGCATTGACCAATGGATGTCCCCAAAGAAGGGTTGGCTACCTCTACTTTTCTTCCCAGCAAGTAGAACAATGTTACCTGAACCACTTGGTGTAGTCCTCATTCTTGGTTCATGGAACTTCCCCATTTCATTGATTTTGGACCCTTTGATTGGGGCAATATCTGCTGG...

Protein

Download Protein FASTA

182 aa · LXL04_038484|LXL04_038484|OH1004|PROTEIN

MGSAYALAEIDIYISFSQIGIVKNSVDQALSCIDQWMSPKKGWLPLLFFPASRTMLPEPLGVVLILGSWNFPISLILDPLIGAISAGNTVMLKPSELAPNCASFLAKIIPVYLDPKAIKVTEGGKEVSKCVDLVVYCHDGLKFVTGIVGTNGYDNYGFVYLHICLSRLVASLSSKYRELRAL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038484`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038484

Location Chr09:42264015-42264964 (-)

Description Similar to ALDH3F1: Aldehyde dehydrogenase family 3 member F1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36250`	Aldehyde dehydrogenase family 3 member F1.	No verified direct reference in this release
`At1g44170`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337
`At4g34240`	Involved in oxidative stress tolerance by detoxifying reactive aldehydes derived from lipid peroxidation.	Engineering the nucleotide coenzyme specificity and sulfhydryl redox sensitivity of two stress-responsive aldehyde dehydrogenase isoenzymes of Arabidopsis thaliana.2011 · DOI: 10.1042/bj20101337

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038484 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006081 aldehyde metabolic process Biological Process

GO:0009269 response to desiccation Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G44170

ath:AT4G34240

ath:AT4G36250

sao:SAOUHSC_02142

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.224

Rank 1 · LXL04_038484 · OH-1004

Peroxisome0.220

Rank 2 · LXL04_038484 · OH-1004

Endoplasmic reticulum0.206

Rank 3 · LXL04_038484 · OH-1004

Mitochondrion0.156

Rank 4 · LXL04_038484 · OH-1004

Nucleus0.108

Rank 5 · LXL04_038484 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171.28Aldedh56-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038484	`PF00171.28`	Aldedh	56	129	4.8e-15	55.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q70E96`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member F1	60.360%	Swiss-Prot	moderate database homology
`Q70DU8`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member H1	46.610%	Swiss-Prot	moderate database homology
`Q8W033`	Arabidopsis thaliana	Aldehyde dehydrogenase family 3 member I1, chloroplastic	43.220%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card