LXL04_037940 | RubberDandelionOmics

Gene overview

LXL04_037940

Reference: OH-1004 Chr: Chr09 Coordinates: 25850503-25860857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5628 bp · LXL04_037940|LXL04_037940|OH1004|cDNA

ATGTTGCAAATCATCTCCCTTCTATATGTGCTGGGTACAATCACATGCGTTGGGTCATCACTAAGCCATGATGAGGAATGCTCAGCCTTATTTCGGTTTAAGAAAAGCATGTTTTATCACGATGATGTTGCTTGTGCTGCCAGCTGGTTTCATACATTTGACTCTTGGAAACTCACAAACAACGAATCAAATGCTGATTTTGATTGTTGTTCGTGGAATGGTGTGGAATGCAGCAACAATGATGTGTACAGTCATGTGGT...

CDS

Download CDS FASTA

5628 bp · LXL04_037940|LXL04_037940|OH1004|CDS

ATGTTGCAAATCATCTCCCTTCTATATGTGCTGGGTACAATCACATGCGTTGGGTCATCACTAAGCCATGATGAGGAATGCTCAGCCTTATTTCGGTTTAAGAAAAGCATGTTTTATCACGATGATGTTGCTTGTGCTGCCAGCTGGTTTCATACATTTGACTCTTGGAAACTCACAAACAACGAATCAAATGCTGATTTTGATTGTTGTTCGTGGAATGGTGTGGAATGCAGCAACAATGATGTGTACAGTCATGTGGT...

Protein

Download Protein FASTA

1875 aa · LXL04_037940|LXL04_037940|OH1004|PROTEIN

MLQIISLLYVLGTITCVGSSLSHDEECSALFRFKKSMFYHDDVACAASWFHTFDSWKLTNNESNADFDCCSWNGVECSNNDVYSHVVGLDLSESFLCGHINSTSTLFSLVHLQNLNLAMNNFDESKIPSEITNLKQLRSLNLSDSRFTGQIPVEMSQLMQLSSLDLSWNPLKLQSPGGLQNMLQNLTRLEKLDLSGVDISSFVPHFLANFSCLRSIMLQNCSLQNKFPDTILALPNLKFLNVARNTNLTGSFPEFRNNNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037940`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037940

Location Chr09:25850503-25860857 (-)

Description Similar to RLP6: Receptor-like protein 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g45616`	Receptor-like protein 6.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At4g13920`	Receptor-like protein 50.	No verified direct reference in this release
`At3g11010`	Receptor-like protein 34.	No verified direct reference in this release
`At4g13900`	Receptor-like protein 49.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037940 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G45616

ath:AT1G47890

ath:AT4G13920

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.823

Rank 1 · LXL04_037940 · OH-1004

Endoplasmic reticulum0.095

Rank 2 · LXL04_037940 · OH-1004

Cytoplasm0.070

Rank 3 · LXL04_037940 · OH-1004

Extracellular0.040

Rank 4 · LXL04_037940 · OH-1004

Nucleus0.037

Rank 5 · LXL04_037940 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_1489-290 aa

PF25013.1LRR_Zer-1181-261 aa

PF23598.2LRR_14207-338 aa

PF13855.13LRR_8260-319 aa

PF23598.2LRR_14279-482 aa

PF13855.13LRR_8624-681 aa

PF23211.1LRR_LRWD1816-899 aa

PF13855.13LRR_8817-875 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037940	`PF23598.2`	LRR_14	89	290	1.5e-63	215.4
LXL04_037940	`PF25013.1`	LRR_Zer-1	181	261	4.4e-19	69.7
LXL04_037940	`PF23598.2`	LRR_14	207	338	1.5e-63	215.4
LXL04_037940	`PF13855.13`	LRR_8	260	319	6.2e-76	250.8
LXL04_037940	`PF23598.2`	LRR_14	279	482	1.5e-63	215.4
LXL04_037940	`PF13855.13`	LRR_8	624	681	6.2e-76	250.8
LXL04_037940	`PF23211.1`	LRR_LRWD1	816	899	2.3e-09	37.9
LXL04_037940	`PF13855.13`	LRR_8	817	875	6.2e-76	250.8
LXL04_037940	`PF23598.2`	LRR_14	977	1126	1.5e-63	215.4
LXL04_037940	`PF29594.1`	LRR_SKP2	987	1174	1.5e-10	41.5
LXL04_037940	`PF23598.2`	LRR_14	1089	1217	1.5e-63	215.4
LXL04_037940	`PF23598.2`	LRR_14	1168	1366	1.5e-63	215.4
LXL04_037940	`PF13855.13`	LRR_8	1260	1318	6.2e-76	250.8
LXL04_037940	`PF13855.13`	LRR_8	1301	1344	6.2e-76	250.8
LXL04_037940	`PF13855.13`	LRR_8	1478	1538	6.2e-76	250.8
LXL04_037940	`PF13855.13`	LRR_8	1504	1560	6.2e-76	250.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C637`	Arabidopsis thaliana	Receptor-like protein 6	37.286%	Swiss-Prot	moderate database homology
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	36.983%	Swiss-Prot	moderate database homology
`Q93YT3`	Arabidopsis thaliana	Receptor-like protein 50	32.392%	Swiss-Prot	moderate database homology
`Q9SRL2`	Arabidopsis thaliana	Receptor-like protein 34	35.325%	Swiss-Prot	weak database homology
`Q9SVM3`	Arabidopsis thaliana	Receptor-like protein 49	38.523%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card