LXL04_037710 | RubberDandelionOmics

Gene overview

LXL04_037710

Reference: OH-1004 Chr: Chr09 Coordinates: 19127633-19133857 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1812 bp · LXL04_037710|LXL04_037710|OH1004|cDNA

TGAGATCTTTCTGACCCTCTTTCGACGGTTATTAGATCCCATCACCAGTGATCGAACCAGATCGTCGCCGGCCACATGGCGAGCAATTCGCTTCTCTTACTCACACTCTCAACTCTCCTCATCTTCACCGTCTCCGGCCGTGTAATCACCACCACGACGACGACTTCAACATCAGATCTCGTCTCTGACGGCGTTCACGATGGCCAAGGCGGCATACTTCGTCTTAACCCCTTCGTATCAGCTGAGGAACCAGAAGCTTG...

CDS

Download CDS FASTA

1737 bp · LXL04_037710|LXL04_037710|OH1004|CDS

ATGGCGAGCAATTCGCTTCTCTTACTCACACTCTCAACTCTCCTCATCTTCACCGTCTCCGGCCGTGTAATCACCACCACGACGACGACTTCAACATCAGATCTCGTCTCTGACGGCGTTCACGATGGCCAAGGCGGCATACTTCGTCTTAACCCCTTCGTATCAGCTGAGGAACCAGAAGCTTGCGAGCAGTCGTACGGATTCTTACCTTGCACCAACACAGCGCTTGGCAACGTCTTCCTCATTTTGGTCTATGGGTA...

Protein

Download Protein FASTA

578 aa · LXL04_037710|LXL04_037710|OH1004|PROTEIN

MASNSLLLLTLSTLLIFTVSGRVITTTTTTSTSDLVSDGVHDGQGGILRLNPFVSAEEPEACEQSYGFLPCTNTALGNVFLILVYGYLMYLAATYLSAGSELLLEILGPGLVGGLLLPILGALPDAMLILVSGLSGSVDVAQDQVSVGMGLLAGSTVMLITVIWGTCIIVGKCDIENSVAIDNTDTKGFSLLGSGVSTDIWTSYSGMIMAVSVLPFIVVQFPQIMHSDSGRHVAVLLGLIVSVSLLITYCIYQVLQPKLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037710`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037710

Location Chr09:19127633-19133857 (-)

Description Similar to NCL: Sodium/calcium exchanger NCL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53210`	Possesses sodium/calcium exchanger (NCX) activity when expressed in a heterologous mammalian CHO-K1 cell system.	No verified direct reference in this release
`At1g55720`	Vacuolar cation/proton exchanger (CAX).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0247800`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release
`Os01g0212400`	May function as a sodium/calcium exchanger (NCX) and participate in the maintenance of calcium homeostasis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037710 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006814 sodium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0055074 calcium ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:0071472 cellular response to salt stress Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G53210

ath:AT1G55720

dosa:Os01g0212400

dosa:Os02g0247800

osa:4325568

osa:4328874

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.579

Rank 1 · LXL04_037710 · OH-1004

Lysosome / Vacuole0.227

Rank 2 · LXL04_037710 · OH-1004

Endoplasmic reticulum0.122

Rank 3 · LXL04_037710 · OH-1004

Cytoplasm0.081

Rank 4 · LXL04_037710 · OH-1004

Golgi apparatus0.051

Rank 5 · LXL04_037710 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01699.30Na_Ca_ex79-255 aa

PF13499.13EF-hand_7298-363 aa

PF01699.30Na_Ca_ex425-569 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037710	`PF01699.30`	Na_Ca_ex	79	255	3.7e-21	76.4
LXL04_037710	`PF13499.13`	EF-hand_7	298	363	1.2e-10	42.3
LXL04_037710	`PF01699.30`	Na_Ca_ex	425	569	3.7e-21	76.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L636`	Arabidopsis thaliana	Sodium/calcium exchanger NCL	64.632%	Swiss-Prot	strong database homology
`Q9LFZ8`	Arabidopsis thaliana	Putative vacuolar cation/proton exchanger 6	32.673%	Swiss-Prot	weak database homology
`Q6K3R5`	Oryza sativa subsp. japonica	Sodium/calcium exchanger NCL2	60.634%	Swiss-Prot	strong database homology
`Q5QNI2`	Oryza sativa subsp. japonica	Sodium/calcium exchanger NCL1	61.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card