LXL04_037108 | RubberDandelionOmics

Gene overview

LXL04_037108

Reference: OH-1004 Chr: Chr08 Coordinates: 53324050-53325914 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

858 bp · LXL04_037108|LXL04_037108|OH1004|cDNA

ATGGCACAAGCTTGCGTTCCCTCTATCAGATTTAACTCTCTCGCTCTCTCTTCTACAAAAAGCCCTAGCTTCGTATCTGAACAGAATTTCCTCCCCCTTCGTTCCAGGAAAGCAAGTAAATTGAGAGTTGGGACATGTTCAGTGAAAGCTGTTTACTCTGGTGATTATTCAACACTTGACAAGAATTCAAGGCAGGGAGTCTGGTCCATTAGggAGGATGTACAAGTTCCATCATCACCCTACTTCCCAGCATATGCACA...

CDS

Download CDS FASTA

858 bp · LXL04_037108|LXL04_037108|OH1004|CDS

ATGGCACAAGCTTGCGTTCCCTCTATCAGATTTAACTCTCTCGCTCTCTCTTCTACAAAAAGCCCTAGCTTCGTATCTGAACAGAATTTCCTCCCCCTTCGTTCCAGGAAAGCAAGTAAATTGAGAGTTGGGACATGTTCAGTGAAAGCTGTTTACTCTGGTGATTATTCAACACTTGACAAGAATTCAAGGCAGGGAGTCTGGTCCATTAGGGAGGATGTACAAGTTCCATCATCACCCTACTTCCCAGCATATGCACA...

Protein

Download Protein FASTA

285 aa · LXL04_037108|LXL04_037108|OH1004|PROTEIN

MAQACVPSIRFNSLALSSTKSPSFVSEQNFLPLRSRKASKLRVGTCSVKAVYSGDYSTLDKNSRQGVWSIREDVQVPSSPYFPAYAQGQGPPPMMQERFQSVISQLFQYRIIRCGGAVDDDMANIIVAQLLYLDAVDPNKDIIMYVNSPGGSVTAGMAIFDTMKHIRPDVSTVCVGLAASMGAFLLGAGTKGKRYSLPNSRIMIHQPLGGAQGGQTDLDIQANEMLHHKANLNGYLAYHTGQSLDRINQDTDRDYFMSAK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037108`
TK1151 ID	TkA04G002630
OH-1004 ID	LXL04_037108
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037108

Location Chr08:53324050-53325914 (+)

Description Similar to CLPP5: ATP-dependent Clp protease proteolytic subunit 5, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02560`	Cleaves peptides in various proteins in a process that requires ATP hydrolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037108 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006515 protein quality control for misfolded or incompletely synthesized proteins Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009368 endopeptidase Clp complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009532 plastid stroma Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009840 chloroplastic endopeptidase Clp complex Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0004176 ATP-dependent peptidase activity Molecular Function

KEGG gene cross-reference

ana:alr1238

ath:AT1G02560

ava:Ava_0547

cya:CYA_1193

cyb:CYB_2581

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.965

Rank 1 · LXL04_037108 · OH-1004

Mitochondrion0.045

Rank 2 · LXL04_037108 · OH-1004

Nucleus0.018

Rank 3 · LXL04_037108 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_037108 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_037108 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00574.29CLP_protease96-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037108	`PF00574.29`	CLP_protease	96	274	8.4e-80	267.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S834`	Arabidopsis thaliana	ATP-dependent Clp protease proteolytic subunit 5, chloroplastic	79.866%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card