LXL04_036714 | RubberDandelionOmics

Gene overview

LXL04_036714

Reference: OH-1004 Chr: Chr08 Coordinates: 46974765-46979982 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2412 bp · LXL04_036714|LXL04_036714|OH1004|cDNA

ATGAACGCTGACGGAATCGACGAGAGTGGAGGAGGAGAGATCGACGGCGAGCAGGCGCTGCGATCGCCGGAACAGCAAGAACGACAGCGGCGCTGCAATCAACTGACGGCAACTCTCCGAGTACAAACACGCCAAAGGAGAGGACTAGAATTGATGTTGTTGTCATCAAAATTTGTTTTTAGAACTAGATTTGATGTTGTTGTCACGACCTGCCGACCAGCCCGATTTCCTTCACAGACCAGCCCGATTTCCTTCACAGA...

CDS

Download CDS FASTA

2412 bp · LXL04_036714|LXL04_036714|OH1004|CDS

ATGAACGCTGACGGAATCGACGAGAGTGGAGGAGGAGAGATCGACGGCGAGCAGGCGCTGCGATCGCCGGAACAGCAAGAACGACAGCGGCGCTGCAATCAACTGACGGCAACTCTCCGAGTACAAACACGCCAAAGGAGAGGACTAGAATTGATGTTGTTGTCATCAAAATTTGTTTTTAGAACTAGATTTGATGTTGTTGTCACGACCTGCCGACCAGCCCGATTTCCTTCACAGACCAGCCCGATTTCCTTCACAGA...

Protein

Download Protein FASTA

803 aa · LXL04_036714|LXL04_036714|OH1004|PROTEIN

MNADGIDESGGGEIDGEQALRSPEQQERQRRCNQLTATLRVQTRQRRGLELMLLSSKFVFRTRFDVVVTTCRPARFPSQTSPISFTDQRSSAISPISFTAKLIDFTAKLKDFSISFTAHRFHGDFSDFSEFFGSFTDQRLLSLSSPFPSVSIAISEFSIAVSRLKVCYQSRLMTTNEAVIDVDVEDQNDDGLETPDKMRSIVWQHFPYKKGAQTSKCNHCNKVLACGVRMCTSGLLNHLRNTCKTSGIYKEHTNDPNKQS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036714`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036714

Location Chr08:46974765-46979982 (-)

Description Similar to HAT: Zinc finger BED domain-containing protein DAYSLEEPER

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42170`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0583200`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os03g0733400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os05g0239150`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release
`Os01g0518400`	Transposase-like protein that is essential for plant growth and development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036714 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT3G42170

dosa:Os01g0518400

dosa:Os03g0733400

dosa:Os05g0239150

dosa:Os05g0583200

osa:4339741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.796

Rank 1 · LXL04_036714 · OH-1004

Cytoplasm0.250

Rank 2 · LXL04_036714 · OH-1004

Endoplasmic reticulum0.031

Rank 3 · LXL04_036714 · OH-1004

Cell membrane0.027

Rank 4 · LXL04_036714 · OH-1004

Mitochondrion0.023

Rank 5 · LXL04_036714 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27041.1ZBED1_RNase-like354-441 aa

PF27039.1ZBED1_RNase-like_helical451-551 aa

PF14372.13hAT-like_RNase-H580-634 aa

PF05699.20Dimer_Tnp_hAT681-763 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036714	`PF27041.1`	ZBED1_RNase-like	354	441	3.7e-24	85.4
LXL04_036714	`PF27039.1`	ZBED1_RNase-like_helical	451	551	9.9e-27	93.9
LXL04_036714	`PF14372.13`	hAT-like_RNase-H	580	634	1.9e-08	35.1
LXL04_036714	`PF05699.20`	Dimer_Tnp_hAT	681	763	2.4e-29	101.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2N5`	Arabidopsis thaliana	Zinc finger BED domain-containing protein DAYSLEEPER	29.394%	Swiss-Prot	weak database homology
`Q75HY5`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 3	28.885%	Swiss-Prot	weak database homology
`Q6AVI0`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 2	27.231%	Swiss-Prot	weak database homology
`B9FJG3`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 1	26.636%	Swiss-Prot	weak database homology
`Q0JMB2`	Oryza sativa subsp. japonica	Zinc finger BED domain-containing protein RICESLEEPER 4	26.040%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card