Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1614 bp · LXL04_035800|LXL04_035800|OH1004|cDNA
ATGTCAAAAGTTCCGACCACCGTCAAGAAACTTCATTCGGTTCAAACTTCATCAAAAGAGAAATTACCCATCTCATTATATCCAGCAATGACGCCGGAGACGGTGACGCTGATACTAGTGAACCTCGCCGGAATAATGGAAAGAGCCGACGAGTCATTGTTACCGGGGGTTTACAAGGAGGTCGGAGAAGAACTCCACGCTGATCCAACGCGGTTGGGCTCGTTGACCCTTTTCCGATCAATCGTTCAGGCGTCATGTTT...
1614 bp · LXL04_035800|LXL04_035800|OH1004|CDS
ATGTCAAAAGTTCCGACCACCGTCAAGAAACTTCATTCGGTTCAAACTTCATCAAAAGAGAAATTACCCATCTCATTATATCCAGCAATGACGCCGGAGACGGTGACGCTGATACTAGTGAACCTCGCCGGAATAATGGAAAGAGCCGACGAGTCATTGTTACCGGGGGTTTACAAGGAGGTCGGAGAAGAACTCCACGCTGATCCAACGCGGTTGGGCTCGTTGACCCTTTTCCGATCAATCGTTCAGGCGTCATGTTT...
Protein
Download Protein FASTA537 aa · LXL04_035800|LXL04_035800|OH1004|PROTEIN
MSKVPTTVKKLHSVQTSSKEKLPISLYPAMTPETVTLILVNLAGIMERADESLLPGVYKEVGEELHADPTRLGSLTLFRSIVQASCFPLAAYLAVRHNRAHIIAYGAFLWAAATFLVALSSSFFQVAISRGLNGIGLAIVGPAIQSLVADSTNNENRGMAFGWLQLTSNLGSIIGGFLSLLLASTTFLGISGWRIAFHLVAVISVIVGIFVRLFADDPRFKQPKPPQNPHQSLWSEVKDLAREAKSVINIKSFQIIASQG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_035800 |
|---|---|
| TK1151 ID | TkA04G107860 |
| OH-1004 ID | LXL04_035800 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 93.296Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_035800 |
|---|---|
| Location | Chr08:29046357-29049083 (-) |
| Description | Similar to spin: Protein spinster |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0002920 regulation of humoral immune response Biological Process GO:0003376 sphingosine-1-phosphate receptor signaling pathway Biological Process GO:0006869 lipid transport Biological Process GO:0006897 endocytosis Biological Process GO:0007040 lysosome organization Biological Process GO:0008333 endosome to lysosome transport Biological Process GO:0009267 cellular response to starvation Biological Process GO:0012501 programmed cell death Biological Process GO:0040011 locomotion Biological Process GO:0043067 regulation of programmed cell death Biological Process GO:0055085 transmembrane transport Biological Process GO:0005765 lysosomal membrane Cellular Component |
| KEGG gene cross-reference | bsu:BSU10980 dme:Dmel_CG8428 dre:568117 xtr:100145187 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF07690.22MFS_142-328 aaPF00083.31Sugar_tr89-222 aaPF07690.22MFS_1335-469 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_035800 | PF07690.22 | MFS_1 | 42 | 328 | 8.9e-49 | 167.0 |
| LXL04_035800 | PF00083.31 | Sugar_tr | 89 | 222 | 5.5e-11 | 42.7 |
| LXL04_035800 | PF07690.22 | MFS_1 | 335 | 469 | 8.9e-49 | 167.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.