LXL04_035618 | RubberDandelionOmics

Gene overview

LXL04_035618

Reference: OH-1004 Chr: Chr08 Coordinates: 25408432-25409369 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_035618|LXL04_035618|OH1004|cDNA

ATGTTTGGTGGGCAAAAACGCGCACTCCACAATCTAAAACAAAAACTACTTGGCGACTCATCTTTCACAACATCGATCAATGAAATCCCACCTGAAATCGAATTATCGGATTACCAAAGAGCACCAAGTCCAGGTTCCGAAAGCCCTTCAGGTCTTCTCAATGGTGAAAGCTTAAAAGTCGAACCAATTGctgacttggatctcttcttTGAAAGATTATACAGCTACTACTGTGAAAAGGGTCTATGGTGCATAATCAT...

CDS

Download CDS FASTA

624 bp · LXL04_035618|LXL04_035618|OH1004|CDS

ATGTTTGGTGGGCAAAAACGCGCACTCCACAATCTAAAACAAAAACTACTTGGCGACTCATCTTTCACAACATCGATCAATGAAATCCCACCTGAAATCGAATTATCGGATTACCAAAGAGCACCAAGTCCAGGTTCCGAAAGCCCTTCAGGTCTTCTCAATGGTGAAAGCTTAAAAGTCGAACCAATTGCTGACTTGGATCTCTTCTTTGAAAGATTATACAGCTACTACTGTGAAAAGGGTCTATGGTGCATAATCAT...

Protein

Download Protein FASTA

207 aa · LXL04_035618|LXL04_035618|OH1004|PROTEIN

MFGGQKRALHNLKQKLLGDSSFTTSINEIPPEIELSDYQRAPSPGSESPSGLLNGESLKVEPIADLDLFFERLYSYYCEKGLWCIIIKWIVELLSLAFTICFSGFFLLFVDWNGLRSAKCGMDAVESGIKPCDLAKEALHEHPLTPLTPFKVVILGYLGITFVYWIFCFLRFFVQLKDTLEICQFYINSLNGSVGFCGAMNKIVKSF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035618`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035618

Location Chr08:25408432-25409369 (+)

Description Similar to ATG9: Autophagy-related protein 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31260`	Phospholipid scramblase involved in autophagy by mediating autophagosomal membrane expansion.	Leaf senescence and starvation-induced chlorosis are accelerated by the disruption of an Arabidopsis autophagy gene.2002 · DOI: 10.1104/pp.011024 A revised assay for monitoring autophagic flux in Arabidopsis thaliana reveals involvement of AUTOPHAGY-RELATED9 in autophagy.2014 · DOI: 10.14348/molcells.2014.0042

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035618 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000422 autophagy of mitochondrion Biological Process

GO:0000423 mitophagy Biological Process

GO:0006907 pinocytosis Biological Process

GO:0006909 phagocytosis Biological Process

GO:0006914 autophagy Biological Process

GO:0009408 response to heat Biological Process

GO:0009617 response to bacterium Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0019954 asexual reproduction Biological Process

GO:0031667 response to nutrient levels Biological Process

GO:0032688 negative regulation of interferon-beta production Biological Process

KEGG gene cross-reference

ath:AT2G31260

ddi:DDB_G0285323

hsa:79065

pon:100174344

rno:363254

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.330

Rank 1 · LXL04_035618 · OH-1004

Endoplasmic reticulum0.281

Rank 2 · LXL04_035618 · OH-1004

Cytoplasm0.266

Rank 3 · LXL04_035618 · OH-1004

Lysosome / Vacuole0.208

Rank 4 · LXL04_035618 · OH-1004

Cell membrane0.176

Rank 5 · LXL04_035618 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04109.22ATG960-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035618	`PF04109.22`	ATG9	60	191	5.5e-26	92.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RUS5`	Arabidopsis thaliana	Autophagy-related protein 9	69.274%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card