LXL04_035587 | RubberDandelionOmics

Gene overview

LXL04_035587

Reference: OH-1004 Chr: Chr08 Coordinates: 25101367-25104275 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1455 bp · LXL04_035587|LXL04_035587|OH1004|cDNA

ATGCATCACTGGGTTCGAGCTTCACCGTCCGATTTTGGTGGACCTCTTCCTACTCCTCGGAGTGGCCACACCGCAGTCAATGTTGGAAAGTCAAAGATCATAGTGTTTGGTGGTCTTGTCGATAAGAATTTCCTCGATGACATCTCTGTATACGACATCGATAACAAGTTATGGTTTCAGCCTCAGTGCACTGGTAGTGGTTCAGATGGCCAAACAGGTCCCAGTCCTAGAGCATTTCACATTGCCATTGCAATCGACTG...

CDS

Download CDS FASTA

1455 bp · LXL04_035587|LXL04_035587|OH1004|CDS

ATGCATCACTGGGTTCGAGCTTCACCGTCCGATTTTGGTGGACCTCTTCCTACTCCTCGGAGTGGCCACACCGCAGTCAATGTTGGAAAGTCAAAGATCATAGTGTTTGGTGGTCTTGTCGATAAGAATTTCCTCGATGACATCTCTGTATACGACATCGATAACAAGTTATGGTTTCAGCCTCAGTGCACTGGTAGTGGTTCAGATGGCCAAACAGGTCCCAGTCCTAGAGCATTTCACATTGCCATTGCAATCGACTG...

Protein

Download Protein FASTA

484 aa · LXL04_035587|LXL04_035587|OH1004|PROTEIN

MHHWVRASPSDFGGPLPTPRSGHTAVNVGKSKIIVFGGLVDKNFLDDISVYDIDNKLWFQPQCTGSGSDGQTGPSPRAFHIAIAIDCHMFVFGGRLGTKRLGDFWVLDTDIWQWSELTSFGDLPSPRDFAAASAIGNHKIVMYGGWDGKKWLSDVFVLDTMSLEWRELAVSGTLPPPRCGHTATMVEKRLLVYGGRGGGGPIMGDLWALKGLIEEDNEAPGWTHLKLPGQAPAARCGHTVTSGGHYLLMFGGHGTGGWLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035587`
TK1151 ID	TkA04G121800
OH-1004 ID	LXL04_035587
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035587

Location Chr08:25101367-25104275 (+)

Description Similar to GPA3: Protein GLUTELIN PRECURSOR ACCUMULATION 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0835800`	Acts synergistically with RAB5A and VPS9A to regulate dense vesicle-mediated post-Golgi trafficking of major storage proteins in the seed endosperm during grain filling and maturation.	GLUTELIN PRECURSOR ACCUMULATION3 encodes a regulator of post-Golgi vesicular traffic essential for vacuolar protein sorting in rice endosperm.2014 · DOI: 10.1105/tpc.113.121376

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035587 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000122 negative regulation of transcription by RNA polymerase II Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0007165 signal transduction Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0019046 release from viral latency Biological Process

GO:0043254 regulation of protein-containing complex assembly Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0045931 positive regulation of mitotic cell cycle Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0050821 protein stabilization Biological Process

KEGG gene cross-reference

dosa:Os03g0835800

maua:101830931

osa:4334700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.543

Rank 1 · LXL04_035587 · OH-1004

Nucleus0.321

Rank 2 · LXL04_035587 · OH-1004

Golgi apparatus0.129

Rank 3 · LXL04_035587 · OH-1004

Cell membrane0.117

Rank 4 · LXL04_035587 · OH-1004

Lysosome / Vacuole0.099

Rank 5 · LXL04_035587 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13415.13Beta-prop_FBX423-165 aa

PF13854.13Kelch_HCF11-66 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC712-195 aa

PF24981.2Beta-prop_ATRN-LZTR115-60 aa

PF01344.32Kelch_120-58 aa

PF24981.2Beta-prop_ATRN-LZTR171-314 aa

PF13854.13Kelch_HCF73-146 aa

PF13418.13Beta-prop_TYW474-162 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035587	`PF13415.13`	Beta-prop_FBX42	3	165	1.4e-61	208.4
LXL04_035587	`PF13854.13`	Kelch_HCF	11	66	3e-33	116.2
LXL04_035587	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	12	195	3.3e-74	249.6
LXL04_035587	`PF24981.2`	Beta-prop_ATRN-LZTR1	15	60	7.5e-35	121.3
LXL04_035587	`PF01344.32`	Kelch_1	20	58	6.4e-29	99.8
LXL04_035587	`PF24981.2`	Beta-prop_ATRN-LZTR1	71	314	7.5e-35	121.3
LXL04_035587	`PF13854.13`	Kelch_HCF	73	146	3e-33	116.2
LXL04_035587	`PF13418.13`	Beta-prop_TYW4	74	162	5.4e-20	73.1
LXL04_035587	`PF01344.32`	Kelch_1	76	120	6.4e-29	99.8
LXL04_035587	`PF25210.2`	Kelch_FKB95	76	174	9.1e-07	29.5
LXL04_035587	`PF01344.32`	Kelch_1	131	169	6.4e-29	99.8
LXL04_035587	`PF07646.22`	Kelch_2	131	170	6e-27	92.9
LXL04_035587	`PF13415.13`	Beta-prop_FBX42	132	210	1.4e-61	208.4
LXL04_035587	`PF13854.13`	Kelch_HCF	137	195	3e-33	116.2
LXL04_035587	`PF13854.13`	Kelch_HCF	217	310	3e-33	116.2
LXL04_035587	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	218	325	3.3e-74	249.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q10AZ7`	Oryza sativa subsp. japonica	Protein GLUTELIN PRECURSOR ACCUMULATION 3	66.126%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card