Gene Card
Gene overview
cDNA / CDS / Protein Sequences
234 bp · LXL04_034585|LXL04_034585|OH1004|cDNA
ATGAAAACGGAGCTTACAAAAATGGATTTTAATATTGTCCAAGCTATCCACGTTGAAGATCTAAAGCATTCTTCAAGGTACAATTCATTCCCATTAACGATATACGATATGAATAGATGGTGGAGAAATACAAGTTGGGATAAGGATTTAAGCTTTGTTCGAGACCGGTTGGTAGAGAATTTCATGTGGACAATTGGTATCAATTACCTGCCTCACTTGAAAGAAAGATGCTAA
234 bp · LXL04_034585|LXL04_034585|OH1004|CDS
ATGAAAACGGAGCTTACAAAAATGGATTTTAATATTGTCCAAGCTATCCACGTTGAAGATCTAAAGCATTCTTCAAGGTACAATTCATTCCCATTAACGATATACGATATGAATAGATGGTGGAGAAATACAAGTTGGGATAAGGATTTAAGCTTTGTTCGAGACCGGTTGGTAGAGAATTTCATGTGGACAATTGGTATCAATTACCTGCCTCACTTGAAAGAAAGATGCTAA
Protein
Download Protein FASTA77 aa · LXL04_034585|LXL04_034585|OH1004|PROTEIN
MKTELTKMDFNIVQAIHVEDLKHSSRYNSFPLTIYDMNRWWRNTSWDKDLSFVRDRLVENFMWTIGINYLPHLKERC
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_034585 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_034585 |
|---|---|
| Location | Chr07:108323232-108323511 (+) |
| Description | Similar to QH5: R-linalool synthase QH5, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0007623 circadian rhythm Biological Process GO:0009611 response to wounding Biological Process GO:0010597 green leaf volatile biosynthetic process Biological Process GO:0016102 diterpenoid biosynthetic process Biological Process GO:0016114 terpenoid biosynthetic process Biological Process GO:0033383 geranyl diphosphate metabolic process Biological Process GO:0043693 monoterpene biosynthetic process Biological Process GO:0046248 alpha-pinene biosynthetic process Biological Process GO:0046250 limonene biosynthetic process Biological Process GO:0009507 chloroplast Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0010333 terpene synthase activity Molecular Function |
| KEGG gene cross-reference | ag:AAF13356 ag:AAF13357 ag:AAK58723 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.