Gene Card
Gene overview
cDNA / CDS / Protein Sequences
643 bp · LXL04_030663|LXL04_030663|OH1004|cDNA
ATGGAATCGGCTGCTATCTCCTTGGCGTCCCTTCCCGTCGATCGAAACAACAACAAATGGCGTGAAGGTGGCGGTGTGTCGCAAGAAAGGAGACATCGAATTACAGGAAGCGGTGATCGGGGAACCGCGGGTGAACAGCGGAGGAGGTGCAGGTCACCGAAAAAGTTTATAATCCACTACAATTTCGAGTTCCTCTTCCCTTATGCCGCCTTACAAGAGAAATTTGCGTACAACATGTGAGAGAAAGTAAACCGATATGG...
387 bp · LXL04_030663|LXL04_030663|OH1004|CDS
ATGGTTACAGCCTACCGGAGGGTCGCCGGAGAGAAAAAAATTAATCTGTTGGTTGTTGCTGATTTCCTTCACAGTCACGGTTGGGAGTTTGAGTTTTCTGTCAGATTTTCTTCACTGCCTTCACAGCCCACAGGAAAAAGACACCAAGAAAGTGCTTTCAGCCCAATAATCTGGAGTTTCTTGTTGCTTCACAGCCTCACAAGTAAGTGCTTTCAGCGTTTTTTGTATGTGACAATTGAGATCATGCTTTCCTATTTCAA...
Protein
Download Protein FASTA128 aa · LXL04_030663|LXL04_030663|OH1004|PROTEIN
MVTAYRRVAGEKKINLLVVADFLHSHGWEFEFSVRFSSLPSQPTGKRHQESAFSPIIWSFLLLHSLTSKCFQRFLYVTIEIMLSYFKFSSNNEDDKPKLVEETRLQLKQIKNRFINQMKRNWHSNSNS
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_030663 |
|---|---|
| TK1151 ID | TkA03G158850 |
| OH-1004 ID | LXL04_030663 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 91.200 |
| Protein coverage (%) | TK1151 39.041 / OH-1004 44.531Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_030663 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:120490312-120491690 (-) | ||||||||||||
| Description | Similar to KNAT7: Homeobox protein knotted-1-like 7 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0010089 xylem development Biological Process GO:0010192 mucilage biosynthetic process Biological Process GO:0010214 seed coat development Biological Process GO:0045892 negative regulation of DNA-templated transcription Biological Process GO:0080001 mucilage extrusion from seed coat Biological Process GO:0080112 seed growth Biological Process GO:2000652 regulation of secondary cell wall biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT1G62990 bna:106394496 dosa:Os03g0123500 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.