LXL04_030590 | RubberDandelionOmics

Gene overview

LXL04_030590

Reference: OH-1004 Chr: Chr06 Coordinates: 119307993-119310038 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1539 bp · LXL04_030590|LXL04_030590|OH1004|cDNA

ATGTTTTGTATAACCTCCATTATCTATGCCAGTATCATTGTTCTCGTAGTCTATGTGTTCTATAAATTAGACACCCGTTATCCTAACGGCCTCCCTCCCGGCCCAACCCCATGGCCCATAGTCGGAAACCTACCTCACCTCGGTCCAATTCCACACCACTCACTGGCAACTTTAGCTACACAATATGGACCTTTGATGCACCTCCGGTTCGGCTTTGTTAATGTGGTGGTGGCGGCATCAGCGTCTGTAGCCAAACAATT...

CDS

Download CDS FASTA

1539 bp · LXL04_030590|LXL04_030590|OH1004|CDS

ATGTTTTGTATAACCTCCATTATCTATGCCAGTATCATTGTTCTCGTAGTCTATGTGTTCTATAAATTAGACACCCGTTATCCTAACGGCCTCCCTCCCGGCCCAACCCCATGGCCCATAGTCGGAAACCTACCTCACCTCGGTCCAATTCCACACCACTCACTGGCAACTTTAGCTACACAATATGGACCTTTGATGCACCTCCGGTTCGGCTTTGTTAATGTGGTGGTGGCGGCATCAGCGTCTGTAGCCAAACAATT...

Protein

Download Protein FASTA

512 aa · LXL04_030590|LXL04_030590|OH1004|PROTEIN

MFCITSIIYASIIVLVVYVFYKLDTRYPNGLPPGPTPWPIVGNLPHLGPIPHHSLATLATQYGPLMHLRFGFVNVVVAASASVAKQFLKDHDAKFSSRPPSSGGKHIAYNYQDLVFAPYGPRWRMLRKICSVHLFSNKALDDFVHVRQEEVAILTRTLFGAGQSPVKLGQLLSICTTNALARVTIGIRVVGNGSRGGDPKADVVNDMVVELIQLAGEFNIGDFIPVLDWLDLQGVAGKMKKLHKRFDSFLNSILEEHKSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030590`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030590

Location Chr06:119307993-119310038 (+)

Description Similar to CYP75B1: Flavonoid 3'-monooxygenase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07990`	Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0320100`	Catalyzes the 3'-hydroxylation of the flavonoid B-ring to the 3',4'-hydroxylated state.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030590 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009411 response to UV Biological Process

GO:0009733 response to auxin Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0080027 response to herbivore Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0010333 terpene synthase activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0016711 flavonoid 3'-monooxygenase activity Molecular Function

KEGG gene cross-reference

ag:AAD56282

ath:AT5G07990

dosa:Os10g0320100

osa:4348304

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.920

Rank 1 · LXL04_030590 · OH-1004

Cell membrane0.038

Rank 2 · LXL04_030590 · OH-1004

Plastid0.034

Rank 3 · LXL04_030590 · OH-1004

Cytoplasm0.032

Rank 4 · LXL04_030590 · OH-1004

Golgi apparatus0.026

Rank 5 · LXL04_030590 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067.28p45032-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030590	`PF00067.28`	p450	32	488	1.9e-102	344.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SD85`	Arabidopsis thaliana	Flavonoid 3'-monooxygenase	66.471%	Swiss-Prot	strong database homology
`Q7G602`	Oryza sativa subsp. japonica	Flavonoid 3'-monooxygenase CYP75B3	61.350%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card