LXL04_030115 | RubberDandelionOmics

Gene overview

LXL04_030115

Reference: OH-1004 Chr: Chr06 Coordinates: 108428204-108430025 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

753 bp · LXL04_030115|LXL04_030115|OH1004|cDNA

ATGGATGCGGAGAAGGAGCGGGGGCACCATGTTTACATCGCTAGAATTGCAGAGCAAGCCGAGAGATACGACGAGATGGTCGAAGCAATGAAATCCATTGCAAAATTGGACGTGGAACTGACTTTAGAGGAAAGAAACCTGTTGTCTGTTGGATACAAAAACGTGATTGGATCAAGAAGAGCTTCATGGAGGATACTTTCATCTATTGAACACAAGGAAGAAAGCAAAGGCCATGAACAAAATGTGAAAAAGATACAGGA...

CDS

Download CDS FASTA

753 bp · LXL04_030115|LXL04_030115|OH1004|CDS

ATGGATGCGGAGAAGGAGCGGGGGCACCATGTTTACATCGCTAGAATTGCAGAGCAAGCCGAGAGATACGACGAGATGGTCGAAGCAATGAAATCCATTGCAAAATTGGACGTGGAACTGACTTTAGAGGAAAGAAACCTGTTGTCTGTTGGATACAAAAACGTGATTGGATCAAGAAGAGCTTCATGGAGGATACTTTCATCTATTGAACACAAGGAAGAAAGCAAAGGCCATGAACAAAATGTGAAAAAGATACAGGA...

Protein

Download Protein FASTA

250 aa · LXL04_030115|LXL04_030115|OH1004|PROTEIN

MDAEKERGHHVYIARIAEQAERYDEMVEAMKSIAKLDVELTLEERNLLSVGYKNVIGSRRASWRILSSIEHKEESKGHEQNVKKIQDYRKRVEDELAVICNDILATIDHHLLPSSKSGESAVFYHKMKGDYFRYLAEFKSTEDRMEVKDQSLKAYEAATTIAASDLSPTHPIRLGLALNFSVFYYEILNSPERACHMAKQAFDEAITELDNLDEESYKDSTMILQLIKDNLTLWTSNISEEGAAGESQGR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_030115`
TK1151 ID	TkA07G374900
OH-1004 ID	LXL04_030115
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_030115

Location Chr06:108428204-108430025 (-)

Description Similar to TFT7: 14-3-3 protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34760`	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030115 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016597 amino acid binding Molecular Function

GO:0045309 protein phosphorylated amino acid binding Molecular Function

GO:0051117 ATPase binding Molecular Function

KEGG gene cross-reference

ath:AT1G34760

gmx:547990

nta:107784347

sly:544114

sly:544213

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.721

Rank 1 · LXL04_030115 · OH-1004

Nucleus0.361

Rank 2 · LXL04_030115 · OH-1004

Cell membrane0.077

Rank 3 · LXL04_030115 · OH-1004

Lysosome / Vacuole0.059

Rank 4 · LXL04_030115 · OH-1004

Golgi apparatus0.058

Rank 5 · LXL04_030115 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00244.2714-3-314-235 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_030115	`PF00244.27`	14-3-3	14	235	4.1e-103	344.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9Z8`	Arabidopsis thaliana	14-3-3-like protein GF14 omicron	75.732%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card