LXL04_029630 | RubberDandelionOmics

Gene overview

LXL04_029630

Reference: OH-1004 Chr: Chr06 Coordinates: 95817856-95819146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

609 bp · LXL04_029630|LXL04_029630|OH1004|cDNA

ATGGTAACCGGAAGCTGCTTTTCTCTCTTTCCCATGGCTAAGATTTATCCTCAAGCTCCATCATCATCACCACCATCTTCATCACCATACTTGAGCTCAAAGCAAGAATGCTTCACAATATGGATGAAATCGCTAGTCTACAACAGCCATGGATGCACTGCCTACAATTCCAAAGGTGAAATCATTTATCGGGTCGATAATTATGACAAGAAATGCAGCTCACGAGTCTACTTAATGGATATTCGAGGCAACGTTCTTTT...

CDS

Download CDS FASTA

609 bp · LXL04_029630|LXL04_029630|OH1004|CDS

ATGGTAACCGGAAGCTGCTTTTCTCTCTTTCCCATGGCTAAGATTTATCCTCAAGCTCCATCATCATCACCACCATCTTCATCACCATACTTGAGCTCAAAGCAAGAATGCTTCACAATATGGATGAAATCGCTAGTCTACAACAGCCATGGATGCACTGCCTACAATTCCAAAGGTGAAATCATTTATCGGGTCGATAATTATGACAAGAAATGCAGCTCACGAGTCTACTTAATGGATATTCGAGGCAACGTTCTTTT...

Protein

Download Protein FASTA

202 aa · LXL04_029630|LXL04_029630|OH1004|PROTEIN

MVTGSCFSLFPMAKIYPQAPSSSPPSSSPYLSSKQECFTIWMKSLVYNSHGCTAYNSKGEIIYRVDNYDKKCSSRVYLMDIRGNVLFSIQRKKLRVFGCWDGYKWDFSKKQRWFRVTSKHQKIHVDLASGQGYKIVKSGGKLGFKIMNLDQDGAVVAEIKRKQTAAGVYLGDDVFTLTVEPNVDQSLIMAIVMVNGLIHRQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029630`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029630

Location Chr06:95817856-95819146 (-)

Description Similar to At3g14260: Protein LURP-one-related 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14260`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g63410`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g53890`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At1g53870`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At2g38640`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029630 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G53870

ath:AT1G53890

ath:AT1G63410

ath:AT2G38640

ath:AT3G14260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.615

Rank 1 · LXL04_029630 · OH-1004

Cytoplasm0.396

Rank 2 · LXL04_029630 · OH-1004

Cell membrane0.150

Rank 3 · LXL04_029630 · OH-1004

Endoplasmic reticulum0.079

Rank 4 · LXL04_029630 · OH-1004

Lysosome / Vacuole0.036

Rank 5 · LXL04_029630 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525.20LOR38-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029630	`PF04525.20`	LOR	38	194	3.2e-35	122.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUM1`	Arabidopsis thaliana	Protein LURP-one-related 11	41.627%	Swiss-Prot	moderate database homology
`Q9SH27`	Arabidopsis thaliana	Protein LURP-one-related 4	43.077%	Swiss-Prot	moderate database homology
`Q67XV7`	Arabidopsis thaliana	Protein LURP-one-related 3	40.191%	Swiss-Prot	moderate database homology
`Q8LG32`	Arabidopsis thaliana	Protein LURP-one-related 2	40.191%	Swiss-Prot	moderate database homology
`Q9ZVI6`	Arabidopsis thaliana	Protein LURP-one-related 8	33.158%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card