LXL04_029588 | RubberDandelionOmics

Gene overview

LXL04_029588

Reference: OH-1004 Chr: Chr06 Coordinates: 94895447-94899450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2172 bp · LXL04_029588|LXL04_029588|OH1004|cDNA

ATGACCGGAGCGGTGATAAATCCGCTGCAAGCAACCGGGACGGTGAACATGCCAACCAGCCAGCCGCCATCTATGTCGGACATGAACTCTGTCCGCATTTCCGTTCTTGTTGATCGATTACTTGTTCACCTTCGCGGCGGTTCAAGGAATGATAGCAATGAGTTTTCTAAACTCTGCATCTCTCTTTCCAGAGCAATTGACTATGCTGTTGCTAACAAGGAGCTTCCGGTCAAAGCTCCAGAATTACCTGGTTTGTTGAA...

CDS

Download CDS FASTA

2172 bp · LXL04_029588|LXL04_029588|OH1004|CDS

ATGACCGGAGCGGTGATAAATCCGCTGCAAGCAACCGGGACGGTGAACATGCCAACCAGCCAGCCGCCATCTATGTCGGACATGAACTCTGTCCGCATTTCCGTTCTTGTTGATCGATTACTTGTTCACCTTCGCGGCGGTTCAAGGAATGATAGCAATGAGTTTTCTAAACTCTGCATCTCTCTTTCCAGAGCAATTGACTATGCTGTTGCTAACAAGGAGCTTCCGGTCAAAGCTCCAGAATTACCTGGTTTGTTGAA...

Protein

Download Protein FASTA

723 aa · LXL04_029588|LXL04_029588|OH1004|PROTEIN

MTGAVINPLQATGTVNMPTSQPPSMSDMNSVRISVLVDRLLVHLRGGSRNDSNEFSKLCISLSRAIDYAVANKELPVKAPELPGLLKQVCQWKRDAPLQAVIMVLLISIKGACRKGWFNEKDTEELQNLSNEISSSFCSVKDMNFGENKFHNSISGVMLRFYPNMKMGETLAFIEANLGYGAFVKDFDITKEAMSSNNKIYLFIAQIDDTETSSCIISPQQVNFLLNGIAVDGRTSLSKDPGPQTPTLVTHMLKLGTNLL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029588`
TK1151 ID	TkA05G029420
OH-1004 ID	LXL04_029588
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	56.900
Protein coverage (%)	TK1151 35.172 / OH-1004 6.916 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029588

Location Chr06:94895447-94899450 (+)

Description Similar to PIAL2: E4 SUMO-protein ligase PIAL2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g41580`	Together with MOM1 and PIAL1, regulates transcriptional gene silencing (TGS) independently of changes in DNA methylation.	Arabidopsis PIAL1 and 2 promote SUMO chain formation as E4-type SUMO ligases and are involved in stress responses and sulfur metabolism.2014 · DOI: 10.1105/tpc.114.131300 The SUMO E3 Ligase-Like Proteins PIAL1 and PIAL2 Interact with MOM1 and Form a Novel Complex Required for Transcriptional Silencing.2016 · DOI: 10.1105/tpc.15.00997
`At1g08910`	Together with MOM1 and PIAL2, regulates transcriptional gene silencing (TGS) independently of changes in DNA methylation.	Arabidopsis PIAL1 and 2 promote SUMO chain formation as E4-type SUMO ligases and are involved in stress responses and sulfur metabolism.2014 · DOI: 10.1105/tpc.114.131300 The SUMO E3 Ligase-Like Proteins PIAL1 and PIAL2 Interact with MOM1 and Form a Novel Complex Required for Transcriptional Silencing.2016 · DOI: 10.1105/tpc.15.00997

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029588 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007131 reciprocal meiotic recombination Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0030999 linear element assembly Biological Process

GO:0031297 replication fork processing Biological Process

GO:0036299 non-recombinational interstrand cross-link repair Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0060966 regulation of gene silencing by regulatory ncRNA Biological Process

GO:0072766 centromere clustering at the mitotic interphase nuclear envelope Biological Process

GO:0120290 stalled replication fork localization to nuclear periphery Biological Process

KEGG gene cross-reference

ath:AT1G08910

ath:AT5G41580

hsa:83637

sce:YOR156C

spo:2541580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · LXL04_029588 · OH-1004

Cytoplasm0.175

Rank 2 · LXL04_029588 · OH-1004

Cell membrane0.032

Rank 3 · LXL04_029588 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_029588 · OH-1004

Lysosome / Vacuole0.013

Rank 5 · LXL04_029588 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26716.1PIAL1_N26-178 aa

PF11789.15zf-Nse310-359 aa

PF02891.27zf-MIZ312-360 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029588	`PF26716.1`	PIAL1_N	26	178	4.2e-63	212.5
LXL04_029588	`PF11789.15`	zf-Nse	310	359	2.6e-07	31.1
LXL04_029588	`PF02891.27`	zf-MIZ	312	360	3.3e-20	72.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JYG0`	Arabidopsis thaliana	E4 SUMO-protein ligase PIAL2	41.102%	Swiss-Prot	moderate database homology
`A0A0A7EPL0`	Arabidopsis thaliana	E4 SUMO-protein ligase PIAL1	46.556%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card