LXL04_029551 | RubberDandelionOmics

Gene overview

LXL04_029551

Reference: OH-1004 Chr: Chr06 Coordinates: 93573793-93574755 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

963 bp · LXL04_029551|LXL04_029551|OH1004|cDNA

ATGGCCCCAGTGAAGCGGACTGTGCACAAGACTACTGTTACAATGGTTAGCAAGTTGTCGTTATCGGAGAAATGCTCGAGGCGGAGGCCGCCGGTGGTGAATAGTGATACTGTGGGTCGTAGAGTTGTGAGAATGTCGGTGACTGATGCTTACGCGACTGATTCTTCCGGTGACGAAGAAGCAGAGCAGCTTTGCCGGCGAAGAGTGAGGAAGTTTGTTCACGAAGTGATGATCGAAGCTGGATCAAAAGATGGTAGTAT...

CDS

Download CDS FASTA

963 bp · LXL04_029551|LXL04_029551|OH1004|CDS

ATGGCCCCAGTGAAGCGGACTGTGCACAAGACTACTGTTACAATGGTTAGCAAGTTGTCGTTATCGGAGAAATGCTCGAGGCGGAGGCCGCCGGTGGTGAATAGTGATACTGTGGGTCGTAGAGTTGTGAGAATGTCGGTGACTGATGCTTACGCGACTGATTCTTCCGGTGACGAAGAAGCAGAGCAGCTTTGCCGGCGAAGAGTGAGGAAGTTTGTTCACGAAGTGATGATCGAAGCTGGATCAAAAGATGGTAGTAT...

Protein

Download Protein FASTA

320 aa · LXL04_029551|LXL04_029551|OH1004|PROTEIN

MAPVKRTVHKTTVTMVSKLSLSEKCSRRRPPVVNSDTVGRRVVRMSVTDAYATDSSGDEEAEQLCRRRVRKFVHEVMIEAGSKDGSIVNGNGNGNKKVSNTGDKLRKKAAAAEKRVKVCSGKKFRGVRQRPWGKWAAEIRDPMRRVRLWLGTFDTAEEAAMVYDTAAIQLRGPDALTNFTVPPLPEKKPSPASSGYNSSNESQNNKTTSPKSVLCFPSASTDESAAESTHINEASDITGVPDTFSDFRHFDDHFSTSHYF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_029551`
TK1151 ID	TkA02G261040
OH-1004 ID	LXL04_029551
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_029551

Location Chr06:93573793-93574755 (-)

Description Similar to CRF2: Ethylene-responsive transcription factor CRF2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g23750`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At4g27950`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At4g11140`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At5g53290`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release
`At3g61630`	Component of the cytokinin signaling pathway involved in cotyledons, leaves, and embryos development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029551 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0048364 root development Biological Process

GO:0048366 leaf development Biological Process

GO:0048825 cotyledon development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0042802 identical protein binding Molecular Function

KEGG gene cross-reference

ath:AT3G61630

ath:AT4G11140

ath:AT4G23750

ath:AT4G27950

ath:AT5G53290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_029551 · OH-1004

Cytoplasm0.093

Rank 2 · LXL04_029551 · OH-1004

Cell membrane0.028

Rank 3 · LXL04_029551 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_029551 · OH-1004

Plastid0.014

Rank 5 · LXL04_029551 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2123-172 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_029551	`PF00847.27`	AP2	123	172	7.2e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUQ2`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF2	40.947%	Swiss-Prot	moderate database homology
`Q9SUE3`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF4	37.536%	Swiss-Prot	moderate database homology
`O82503`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF1	41.365%	Swiss-Prot	moderate database homology
`Q9FK12`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF3	48.404%	Swiss-Prot	moderate database homology
`Q9M374`	Arabidopsis thaliana	Ethylene-responsive transcription factor CRF6	34.892%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card