LXL04_028924 | RubberDandelionOmics

Gene overview

LXL04_028924

Reference: OH-1004 Chr: Chr06 Coordinates: 74762956-74766002 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · LXL04_028924|LXL04_028924|OH1004|cDNA

ATGGGTTCCCAACTAACCCGTACTTCCCAAGATGCAGCGAGGTGTCTACCGAATTTTTCCTCTCAACTCTCCACCAACCCCTTCCCCATTTCCTCACCAACAACTCGTATAAAGGCTGCTTTCATTCTCTCTCCTCCATCTACCTTCCCATCTGCGCGCTACACGCCTACACCTAAGGCTGCAATGGAGCTCGTAACACCTGCTATCGAGAAGATGGGCGGAAGGGAAGGGATTAGGAGGAATTCGACCTTAATTTGTGC...

CDS

Download CDS FASTA

1770 bp · LXL04_028924|LXL04_028924|OH1004|CDS

ATGGGTTCCCAACTAACCCGTACTTCCCAAGATGCAGCGAGGTGTCTACCGAATTTTTCCTCTCAACTCTCCACCAACCCCTTCCCCATTTCCTCACCAACAACTCGTATAAAGGCTGCTTTCATTCTCTCTCCTCCATCTACCTTCCCATCTGCGCGCTACACGCCTACACCTAAGGCTGCAATGGAGCTCGTAACACCTGCTATCGAGAAGATGGGCGGAAGGGAAGGGATTAGGAGGAATTCGACCTTAATTTGTGC...

Protein

Download Protein FASTA

589 aa · LXL04_028924|LXL04_028924|OH1004|PROTEIN

MGSQLTRTSQDAARCLPNFSSQLSTNPFPISSPTTRIKAAFILSPPSTFPSARYTPTPKAAMELVTPAIEKMGGREGIRRNSTLICAPIMADTVDQMVIQMNSAKSYGADLVEIRLDSLKEFSVPEDIQTLVKLSPLPTLFTYRPTWEGGQYSGDEESRLDALRLAMELGADHIDVELQAVDDFNNLIKGDKPTKCKLIVSSHNYENTPSVEELGNLVARIQSTGADIVKFATTAVDITDVARVFQITAHSQVPIIAMVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028924`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028924

Location Chr06:74762956-74766002 (+)

Description Similar to EMB3004: Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06350`	Bifunctional dehydroquinate dehydratase-shikimate dehydrogenase enzyme that catalyzes two steps in the chorismate biosynthesis pathway.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028924 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0009423 chorismate biosynthetic process Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0019632 shikimate metabolic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003855 3-dehydroquinate dehydratase activity Molecular Function

GO:0004764 shikimate 3-dehydrogenase (NADP+) activity Molecular Function

GO:0050661 NADP binding Molecular Function

KEGG gene cross-reference

ath:AT3G06350

bcb:BCB4264_A4454

bce:BC4331

bcu:BCAH820_4356

btk:BT9727_4070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.966

Rank 1 · LXL04_028924 · OH-1004

Cytoplasm0.047

Rank 2 · LXL04_028924 · OH-1004

Mitochondrion0.045

Rank 3 · LXL04_028924 · OH-1004

Peroxisome0.036

Rank 4 · LXL04_028924 · OH-1004

Nucleus0.025

Rank 5 · LXL04_028924 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01487.23DHquinase_I85-307 aa

PF08501.17Shikimate_dh_N317-397 aa

PF01488.27Shikimate_DH437-508 aa

PF18317.7SDH_C557-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_028924	`PF01487.23`	DHquinase_I	85	307	9.2e-74	249.0
LXL04_028924	`PF08501.17`	Shikimate_dh_N	317	397	1.3e-26	93.3
LXL04_028924	`PF01488.27`	Shikimate_DH	437	508	2.9e-08	34.6
LXL04_028924	`PF18317.7`	SDH_C	557	584	1.2e-08	35.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SQT8`	Arabidopsis thaliana	Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic	66.667%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card