LXL04_026930 | RubberDandelionOmics

Gene overview

LXL04_026930

Reference: OH-1004 Chr: Chr06 Coordinates: 5481646-5485119 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · LXL04_026930|LXL04_026930|OH1004|cDNA

CCCCCAATCACAGCCACTGTACTCTCTTTCTTCCCCTGTAAATTTCCTCCCTCACCGAGCTCAACACCACTTCCCCAAATCACAACCACCCCACTCTCTACATTTCTAGGGTTCTTATTTCCAGCAACCAATCTTCTTCACAAAAGCTCAGACGAAACTTTATGTGAACAAATTTCTTCAACAATGGGCTGCTTCCAGTCCAAAACCGCCAATGTTCAAACCCCCGATGATCAAGTCCCTGAATCCAAACCAGATCTAGG...

CDS

Download CDS FASTA

1503 bp · LXL04_026930|LXL04_026930|OH1004|CDS

ATGGGCTGCTTCCAGTCCAAAACCGCCAATGTTCAAACCCCCGATGATCAAGTCCCTGAATCCAAACCAGATCTAGGCAATGGAGATGAAGGATCAGATCAACAAGATCAGAGTAAAGATCAAGTAGTTCCTGCATTCAAAGAGTTCGAACTCACGGAGCTTCGAGCTGCCACGAATGGGTTTAAAAGCGACCTTATAGTTTCGGAAAGCGGAGAGAAAGCTCCAAATGTGGTTTATAGAGGGAAGCTTCGTAGCAATAA...

Protein

Download Protein FASTA

500 aa · LXL04_026930|LXL04_026930|OH1004|PROTEIN

MGCFQSKTANVQTPDDQVPESKPDLGNGDEGSDQQDQSKDQVVPAFKEFELTELRAATNGFKSDLIVSESGEKAPNVVYRGKLRSNKIVAIKRFSKLSWPDPQQFVAEAAGVGKVRHKRLVNLIGCCAEGEERLLVAEYMPNDTLSKHLFHWDKQPLPWEMRVRVANHIAQALDHCNTENRKIYHDLNAYRVLFDEDGDPRLSSFGLMKNSRDGKSYSTNLAYTPPEFLRTGRVIPESVIYSYGTVLLDLLSGKHIPPSH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026930`
TK1151 ID	TkA07G018610
OH-1004 ID	LXL04_026930
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 89.127 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026930

Location Chr06:5481646-5485119 (+)

Description Similar to BSK2: Serine/threonine-protein kinase BSK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46570`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973
`At4g35230`	Serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.2008 · DOI: 10.1126/science.1156973 BR-SIGNALING KINASE1 physically associates with FLAGELLIN SENSING2 and regulates plant innate immunity in Arabidopsis.2013 · DOI: 10.1105/tpc.112.107904
`At5g59010`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	A mutation in Arabidopsis BSK5 encoding a brassinosteroid-signaling kinase protein affects responses to salinity and abscisic acid.2012 · DOI: 10.1016/j.bbrc.2012.08.118
`At3g54030`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release
`At1g63500`	Probable serine/threonine kinase that acts as a positive regulator of brassinosteroid (BR) signaling downstream of the receptor kinase BRI1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026930 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009898 cytoplasmic side of plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G63500

ath:AT3G54030

ath:AT4G35230

ath:AT5G46570

ath:AT5G59010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.639

Rank 1 · LXL04_026930 · OH-1004

Cytoplasm0.229

Rank 2 · LXL04_026930 · OH-1004

Nucleus0.189

Rank 3 · LXL04_026930 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_026930 · OH-1004

Golgi apparatus0.036

Rank 5 · LXL04_026930 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr77-312 aa

PF00069.32Pkinase77-312 aa

PF25575.1TPR_BSK1_C351-468 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026930	`PF07714.24`	PK_Tyr_Ser-Thr	77	312	4.2e-26	92.5
LXL04_026930	`PF00069.32`	Pkinase	77	312	3.1e-25	89.8
LXL04_026930	`PF25575.1`	TPR_BSK1_C	351	468	3.1e-52	176.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS26`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK2	76.553%	Swiss-Prot	strong database homology
`Q944A7`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK1	63.020%	Swiss-Prot	strong database homology
`Q9FIL1`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK5	60.341%	Swiss-Prot	strong database homology
`Q9M324`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK6	59.283%	Swiss-Prot	strong database homology
`F4I3M3`	Arabidopsis thaliana	Serine/threonine-protein kinase BSK7	57.287%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card