LXL04_026895 | RubberDandelionOmics

Gene overview

LXL04_026895

Reference: OH-1004 Chr: Chr06 Coordinates: 4836222-4838258 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1271 bp · LXL04_026895|LXL04_026895|OH1004|cDNA

ATGTCATTAGAGCTCTTATGAGAAAACCAGAATTGGATACTACAAAACAAAGACATCTCCTCCCAATTAAACTTCAAGATTTACACGGAAACATAATTGACGTAAGCTTGTGGAAAGATTTGGCACACCAACTGAATGATTTTATTACACTTAATCAAGACCGCATTCATGTTATTGTTGCCCTCCAGTTTGGCAAGAAACATTTATATAATGGTAAGCAAAGTGTCACATCTTGGTGGGATCATTCGAAATTATTCGTC...

CDS

Download CDS FASTA

1218 bp · LXL04_026895|LXL04_026895|OH1004|CDS

ATGAGAAAACCAGAATTGGATACTACAAAACAAAGACATCTCCTCCCAATTAAACTTCAAGATTTACACGGAAACATAATTGACGTAAGCTTGTGGAAAGATTTGGCACACCAACTGAATGATTTTATTACACTTAATCAAGACCGCATTCATGTTATTGTTGCCCTCCAGTTTGGCAAGAAACATTTATATAATGGTAAGCAAAGTGTCACATCTTGGTGGGATCATTCGAAATTATTCGTCAACAAAGATTGGCCTGA...

Protein

Download Protein FASTA

405 aa · LXL04_026895|LXL04_026895|OH1004|PROTEIN

MRKPELDTTKQRHLLPIKLQDLHGNIIDVSLWKDLAHQLNDFITLNQDRIHVIVALQFGKKHLYNGKQSVTSWWDHSKLFVNKDWPEINKFKEIYLARYGSEESSTAVSELSSPLVSNNDDFWTKHPIKYINEVLDPIQIQTFIIVGKIVSIRQDQEWYYLSCTACPSKVTEKWLTKDLPDGSKSDPSMVFECKNRRCLKLNKDPIPRFKIPVVVQDSNGSIVLTLFDRDAMSLVQHSCKALVEKINRLEFNLALFPDEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026895`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026895

Location Chr06:4836222-4838258 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0776800`	Component of the replication protein A complex (RPA) required for DNA recombination, repair and replication.	Two types of replication protein A in seed plants.2005 · DOI: 10.1111/j.1742-4658.2005.04719.x Replication protein A (RPA1a) is required for meiotic and somatic DNA repair but is dispensable for DNA replication and homologous recombination in rice.2009 · DOI: 10.1104/pp.109.142877

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026895 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006289 nucleotide-excision repair Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0007140 male meiotic nuclear division Biological Process

GO:0009555 pollen development Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005662 DNA replication factor A complex Cellular Component

GO:0003684 damaged DNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0043047 single-stranded telomeric DNA binding Molecular Function

KEGG gene cross-reference

dosa:Os02g0776800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.969

Rank 1 · LXL04_026895 · OH-1004

Cytoplasm0.103

Rank 2 · LXL04_026895 · OH-1004

Cell membrane0.017

Rank 3 · LXL04_026895 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_026895 · OH-1004

Endoplasmic reticulum0.009

Rank 5 · LXL04_026895 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08646.17Rep_fac-A_C143-292 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026895	`PF08646.17`	Rep_fac-A_C	143	292	4.9e-09	36.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6YZ49`	Oryza sativa subsp. japonica	Replication protein A 70 kDa DNA-binding subunit A	22.314%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card