LXL04_026731 | RubberDandelionOmics

Gene overview

LXL04_026731

Reference: OH-1004 Chr: Chr06 Coordinates: 2108831-2122168 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1308 bp · LXL04_026731|LXL04_026731|OH1004|cDNA

ATGGCTTTGTCATCAAAAAAATTTCTAGCCATGACCATTTTGGTGTTGGCATTTCTTTGCATTGCATTTGTACCAAGTCTAGTGATGGAGTTTCTAGGGGACGTGCCTTCGCTTCAACGACTTCCGAGCTCGTCTATACGGAAAATAGCTCAACACGTTATCGTTAAACGTTATAATTCTGGAGAATATATTCTCAAAGAAAGGGAACTTGCGGGTGGAACTTACTTTATTTATGAGGGCGTGGTGGAAGTCAGCGGTCA...

CDS

Download CDS FASTA

1308 bp · LXL04_026731|LXL04_026731|OH1004|CDS

ATGGCTTTGTCATCAAAAAAATTTCTAGCCATGACCATTTTGGTGTTGGCATTTCTTTGCATTGCATTTGTACCAAGTCTAGTGATGGAGTTTCTAGGGGACGTGCCTTCGCTTCAACGACTTCCGAGCTCGTCTATACGGAAAATAGCTCAACACGTTATCGTTAAACGTTATAATTCTGGAGAATATATTCTCAAAGAAAGGGAACTTGCGGGTGGAACTTACTTTATTTATGAGGGCGTGGTGGAAGTCAGCGGTCA...

Protein

Download Protein FASTA

435 aa · LXL04_026731|LXL04_026731|OH1004|PROTEIN

MALSSKKFLAMTILVLAFLCIAFVPSLVMEFLGDVPSLQRLPSSSIRKIAQHVIVKRYNSGEYILKERELAGGTYFIYEGVVEVSGQFHTHNNDSQVFEWRKFDYFTQSESIRQEDVIALTKLTCLMLPYKYSFLMDPKSIWSEDMNLETIAPVEHILSLEPLDVNTFRGITLKGAPKSNKALAAASKTVHFLKILHSFHAHFLLPGDINIPVIYQVDRLGDVCNVATRRVNAVQKERIVFFLIASFHREEEEEEGFDHQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026731`
TK1151 ID	TkA07G004590
OH-1004 ID	LXL04_026731
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 93.143 / OH-1004 37.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026731

Location Chr06:2108831-2122168 (-)

Description Similar to tesB: Acyl-CoA thioesterase 2 (Escherichia coli (strain K12)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01710`	Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels.	No verified direct reference in this release
`At4g00520`	Catalyzes the hydrolysis of acyl-CoAs into free fatty acids and coenzyme A (CoASH), regulating their respective intracellular levels (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026731 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006637 acyl-CoA metabolic process Biological Process

GO:0009062 fatty acid catabolic process Biological Process

GO:0010561 negative regulation of glycoprotein biosynthetic process Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process

GO:0036109 alpha-linolenic acid metabolic process Biological Process

GO:0043649 dicarboxylic acid catabolic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005782 peroxisomal matrix Cellular Component

KEGG gene cross-reference

ath:AT1G01710

ath:AT4G00520

ece:Z0564

ecj:JW0442

eco:b0452

ecoc:C3026_02215

ecs:ECs_0506

hsa:10005

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Peroxisome0.573

Rank 1 · LXL04_026731 · OH-1004

Cytoplasm0.165

Rank 2 · LXL04_026731 · OH-1004

Mitochondrion0.122

Rank 3 · LXL04_026731 · OH-1004

Endoplasmic reticulum0.082

Rank 4 · LXL04_026731 · OH-1004

Nucleus0.075

Rank 5 · LXL04_026731 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13622.134HBT_3182-247 aa

PF20789.44HBT_3C316-426 aa

PF02551.22Acyl_CoA_thio324-425 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026731	`PF13622.13`	4HBT_3	182	247	3.4e-07	31.1
LXL04_026731	`PF20789.4`	4HBT_3C	316	426	4e-22	79.6
LXL04_026731	`PF02551.22`	Acyl_CoA_thio	324	425	6.1e-29	101.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HU51`	Arabidopsis thaliana	Acyl-CoA hydrolase 2	51.313%	Swiss-Prot	strong database homology
`Q5FYU1`	Arabidopsis thaliana	Acyl-CoA hydrolase 1	47.255%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card