LXL04_026443 | RubberDandelionOmics

Gene overview

LXL04_026443

Reference: OH-1004 Chr: Chr05 Coordinates: 126383489-126394141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

8061 bp · LXL04_026443|LXL04_026443|OH1004|cDNA

ATGGCGAACTTGTATAGTCTAGTTCACGAACTTCGTGAACGAATCGCAGCATCATCCTCAACACCTCCCAACAAATCAGATGATACCTCTTTAGAGCTCCGATTTCGCGCCGTCATCCCGAATCTCCTCCAAGCCTACGTCGTCCCGCATTCCTCCGCTAACGAGAGGGAGGTGATTGCTGTACTGAAATTATTGACTCATACAGTCAATAATTTTCCAGGAGTTTTCTTCCATGGAAAGGCCAGTGCTATTTTACCTGT...

CDS

Download CDS FASTA

8061 bp · LXL04_026443|LXL04_026443|OH1004|CDS

ATGGCGAACTTGTATAGTCTAGTTCACGAACTTCGTGAACGAATCGCAGCATCATCCTCAACACCTCCCAACAAATCAGATGATACCTCTTTAGAGCTCCGATTTCGCGCCGTCATCCCGAATCTCCTCCAAGCCTACGTCGTCCCGCATTCCTCCGCTAACGAGAGGGAGGTGATTGCTGTACTGAAATTATTGACTCATACAGTCAATAATTTTCCAGGAGTTTTCTTCCATGGAAAGGCCAGTGCTATTTTACCTGT...

Protein

Download Protein FASTA

2686 aa · LXL04_026443|LXL04_026443|OH1004|PROTEIN

MANLYSLVHELRERIAASSSTPPNKSDDTSLELRFRAVIPNLLQAYVVPHSSANEREVIAVLKLLTHTVNNFPGVFFHGKASAILPVICRILPFFAEPSFCSRHGVIFETLGSLLSLLRTGDRDAYRQFFEDVMGVVKDLKTIASTVNNTSKQEQEVFLRCFHDSLSGISNDSAFLVELPACNKPTNGFGILINLTGIARWQPFATWIIKVSCKCLTEGALNVEGLVNVPFVLAACKLLCYGDAALQMACFDLVRILGAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026443`
TK1151 ID	TkA06G010510
OH-1004 ID	LXL04_026443
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026443

Location Chr05:126383489-126394141 (+)

Description Similar to ATR: Serine/threonine-protein kinase ATR

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40820`	Probable serine/threonine kinase.	ATR regulates a G2-phase cell-cycle checkpoint in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.018903 Ionizing radiation-dependent gamma-H2AX focus formation requires ataxia telangiectasia mutated and ataxia telangiectasia mutated and Rad3-related.2005 · DOI: 10.1091/mbc.e04-10-0890

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0724700`	Probable serine/threonine kinase.	No verified direct reference in this release
`UniProt: A2YH41`	Probable serine/threonine kinase.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026443 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000077 DNA damage checkpoint signaling Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0006139 nucleobase-containing compound metabolic process Biological Process

GO:0006260 DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0006282 regulation of DNA repair Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006303 double-strand break repair via nonhomologous end joining Biological Process

GO:0006952 defense response Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0008156 negative regulation of DNA replication Biological Process

KEGG gene cross-reference

ath:AT5G40820

hsa:545

xla:398197

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.646

Rank 1 · LXL04_026443 · OH-1004

Cytoplasm0.285

Rank 2 · LXL04_026443 · OH-1004

Cell membrane0.069

Rank 3 · LXL04_026443 · OH-1004

Golgi apparatus0.067

Rank 4 · LXL04_026443 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_026443 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08064.19UME1086-1186 aa

PF25030.1M-HEAT_ATR1455-1711 aa

PF02259.30FAT1778-2149 aa

PF23593.2HEAT_ATR2176-2273 aa

PF00454.34PI3_PI4_kinase2370-2615 aa

PF02260.26FATC2655-2686 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026443	`PF08064.19`	UME	1086	1186	2e-16	60.4
LXL04_026443	`PF25030.1`	M-HEAT_ATR	1455	1711	6.1e-35	121.4
LXL04_026443	`PF02259.30`	FAT	1778	2149	1.7e-52	179.5
LXL04_026443	`PF23593.2`	HEAT_ATR	2176	2273	5.5e-31	107.1
LXL04_026443	`PF00454.34`	PI3_PI4_kinase	2370	2615	1.7e-56	192.6
LXL04_026443	`PF02260.26`	FATC	2655	2686	1.7e-13	50.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FKS4`	Arabidopsis thaliana	Serine/threonine-protein kinase ATR	60.109%	Swiss-Prot	strong database homology
`Q5Z987`	Oryza sativa subsp. japonica	Serine/threonine-protein kinase ATR	57.372%	Swiss-Prot	strong database homology
`A2YH41`	Oryza sativa subsp. indica	Serine/threonine-protein kinase ATR	57.335%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card