LXL04_025933 | RubberDandelionOmics

Gene overview

LXL04_025933

Reference: OH-1004 Chr: Chr05 Coordinates: 118673721-118676948 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1773 bp · LXL04_025933|LXL04_025933|OH1004|cDNA

ATGGCCATTCTCCTTAAATATTTTCAATGGTCATTGACATCATACATTCTATTGCTATGTTGTTTGGTGGACATATGTCAAGGTCTCACTCCAGATGGTGAAGCTTTGGTTAACTTCAGGACAAGTATAATTAGTTCGGATGAGGTTCTTGGTGAATGGAGACCAGAGGATCCTGATCCATGTGGATGGAAAGGAGTAACATGTGATCCAAAAACCATGAGAGTTGTATCTTTGAATGTTTCAAATCACAAATTAAAGGG...

CDS

Download CDS FASTA

1773 bp · LXL04_025933|LXL04_025933|OH1004|CDS

ATGGCCATTCTCCTTAAATATTTTCAATGGTCATTGACATCATACATTCTATTGCTATGTTGTTTGGTGGACATATGTCAAGGTCTCACTCCAGATGGTGAAGCTTTGGTTAACTTCAGGACAAGTATAATTAGTTCGGATGAGGTTCTTGGTGAATGGAGACCAGAGGATCCTGATCCATGTGGATGGAAAGGAGTAACATGTGATCCAAAAACCATGAGAGTTGTATCTTTGAATGTTTCAAATCACAAATTAAAGGG...

Protein

Download Protein FASTA

590 aa · LXL04_025933|LXL04_025933|OH1004|PROTEIN

MAILLKYFQWSLTSYILLLCCLVDICQGLTPDGEALVNFRTSIISSDEVLGEWRPEDPDPCGWKGVTCDPKTMRVVSLNVSNHKLKGLISPYIGKLDNLKFLDLHYNNFYGEIPPELGNCTGLQGLFLQNNYLSGYIPTGLGNLSNLQTLDISSNSLDGRIPTSIGNLRNLLNLNVSSNFLAGPIPTDGVLGRFGSNSFVGNSDLCGNQINKLCKDETVNQQPTGGQNVKKNSGRLLVSASATVGALLLVALMCFWGCFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025933`
TK1151 ID	TkA06G036600
OH-1004 ID	LXL04_025933
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025933

Location Chr05:118673721-118676948 (-)

Description Similar to FEI1: LRR receptor-like serine/threonine-protein kinase FEI 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31420`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354
`At2g35620`	Involved in the signaling pathway that regulates cell wall function, including cellulose biosynthesis, likely via an 1- aminocyclopropane-1-carboxylic acid (ACC)-mediated signal (a precursor of ethylene).	Two leucine-rich repeat receptor kinases mediate signaling, linking cell wall biosynthesis and ACC synthase in Arabidopsis.2008 · DOI: 10.1105/tpc.108.063354

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0457800`	LRR receptor kinase involved in positive regulation of somatic embryogenesis and defense response against the rice blast fungus pathogen Magnaporthe oryzae.	Rice SERK1 gene positively regulates somatic embryogenesis of cultured cell and host defense response against fungal infection.2005 · DOI: 10.1007/s00425-005-1534-4 An XA21-associated kinase (OsSERK2) regulates immunity mediated by the XA21 and XA3 immune receptors.2014 · DOI: 10.1093/mp/ssu003
`UniProt: B8BB68`	LRR receptor kinase involved in defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025933 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009832 plant-type cell wall biogenesis Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0030154 cell differentiation Biological Process

GO:0040008 regulation of growth Biological Process

GO:0045089 positive regulation of innate immune response Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT1G31420

ath:AT2G35620

dosa:Os04g0457800

dosa:Os08g0174700

osa:4336035

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.877

Rank 1 · LXL04_025933 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_025933 · OH-1004

Cytoplasm0.063

Rank 3 · LXL04_025933 · OH-1004

Nucleus0.038

Rank 4 · LXL04_025933 · OH-1004

Lysosome / Vacuole0.025

Rank 5 · LXL04_025933 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_231-69 aa

PF13855.13LRR_8122-179 aa

PF23598.2LRR_14137-179 aa

PF00069.32Pkinase305-570 aa

PF07714.24PK_Tyr_Ser-Thr306-571 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025933	`PF08263.18`	LRRNT_2	31	69	6.7e-11	43.0
LXL04_025933	`PF13855.13`	LRR_8	122	179	4.6e-06	27.0
LXL04_025933	`PF23598.2`	LRR_14	137	179	1.1e-09	38.2
LXL04_025933	`PF00069.32`	Pkinase	305	570	6.9e-46	157.5
LXL04_025933	`PF07714.24`	PK_Tyr_Ser-Thr	306	571	3.1e-41	142.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGF4`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FEI 1	72.968%	Swiss-Prot	strong database homology
`C0LGL9`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FEI 2	70.812%	Swiss-Prot	strong database homology
`Q7XV05`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	35.420%	Swiss-Prot	moderate database homology
`B8BB68`	Oryza sativa subsp. indica	LRR receptor kinase BAK1	35.628%	Swiss-Prot	moderate database homology
`Q6Z4U4`	Oryza sativa subsp. japonica	LRR receptor kinase BAK1	35.628%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card