LXL04_025877 | RubberDandelionOmics

Gene overview

LXL04_025877

Reference: OH-1004 Chr: Chr05 Coordinates: 118029612-118031211 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · LXL04_025877|LXL04_025877|OH1004|cDNA

ATGCCAGGATTAACATGCAACGCGTGCAACAAAGTACTCATAGATGAAAACGATCAAAAGAAACATTACAAGTCCGAATGGCACCGCTTCAACCTCAAACGCAAGATTGCAGGGGTTCCAGGAGTAACAGACGCACTCTTCCTAGCCAGACAATCCGCAATTGCAGAAGAGGAAAGTAAGCTCAGCGAGCCTCCAATGCTGTATACTTGTAGCCTTTGCGGCAAAGGATATAGAACTTCTATGGCTCATGCTCAGCATCT...

CDS

Download CDS FASTA

1122 bp · LXL04_025877|LXL04_025877|OH1004|CDS

ATGCCAGGATTAACATGCAACGCGTGCAACAAAGTACTCATAGATGAAAACGATCAAAAGAAACATTACAAGTCCGAATGGCACCGCTTCAACCTCAAACGCAAGATTGCAGGGGTTCCAGGAGTAACAGACGCACTCTTCCTAGCCAGACAATCCGCAATTGCAGAAGAGGAAAGTAAGCTCAGCGAGCCTCCAATGCTGTATACTTGTAGCCTTTGCGGCAAAGGATATAGAACTTCTATGGCTCATGCTCAGCATCT...

Protein

Download Protein FASTA

373 aa · LXL04_025877|LXL04_025877|OH1004|PROTEIN

MPGLTCNACNKVLIDENDQKKHYKSEWHRFNLKRKIAGVPGVTDALFLARQSAIAEEESKLSEPPMLYTCSLCGKGYRTSMAHAQHLKSRAHISRASENEITAIITPLPPNKHSQYKQQLDNESDEWEEVDQTSNLVSETTSPSDEEEQELDPTSCFMCDQNHKTIENCMIHMHRHHGFFVPDVEYLKDPRGLLTYLGLKVKRDYECLYCNINSQPFNSLEAVRKHMAAKSHCRVHYGDGDDEEEEAELDEFYDYSTSYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025877`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025877

Location Chr05:118029612-118031211 (+)

Description Similar to REIL1: Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31420`	Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit.	The REIL1 and REIL2 proteins of Arabidopsis thaliana are required for leaf growth in the cold.2013 · DOI: 10.1104/pp.113.223925
`At2g24500`	Pre-60S-associated factor involved in the cytoplasmic maturation of the 60S subunit.	The REIL1 and REIL2 proteins of Arabidopsis thaliana are required for leaf growth in the cold.2013 · DOI: 10.1104/pp.113.223925

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025877 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006913 nucleocytoplasmic transport Biological Process

GO:0009631 cold acclimation Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0046330 positive regulation of JNK cascade Biological Process

GO:0090070 positive regulation of ribosome biogenesis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G24500

ath:AT4G31420

mmu:52521

sce:YLR387C

spo:2539563

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.779

Rank 1 · LXL04_025877 · OH-1004

Cytoplasm0.341

Rank 2 · LXL04_025877 · OH-1004

Mitochondrion0.026

Rank 3 · LXL04_025877 · OH-1004

Cell membrane0.017

Rank 4 · LXL04_025877 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_025877 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12171.15zf-C2H2_jaz5-29 aa

PF12756.14zf-C2H2_2156-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025877	`PF12171.15`	zf-C2H2_jaz	5	29	1.1e-07	32.6
LXL04_025877	`PF12756.14`	zf-C2H2_2	156	259	4.5e-29	101.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1G5`	Arabidopsis thaliana	Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1	55.746%	Swiss-Prot	strong database homology
`Q9ZQ18`	Arabidopsis thaliana	Cytoplasmic 60S subunit biogenesis factor REI1 homolog 2	55.138%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card