LXL04_025266 | RubberDandelionOmics

Gene overview

LXL04_025266

Reference: OH-1004 Chr: Chr05 Coordinates: 108925354-108927019 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

762 bp · LXL04_025266|LXL04_025266|OH1004|cDNA

ATGGCGGAGGAGTATTCATGCGACGACGCCATTGAAGAACTGAAGAAGCTTCTCAGTGAGAAAAGCGAACTTGAAACTGTCGCCGCCGCTAAAATCAAGCAACTAACGGCTGATCTGGAGAAAGCCGTTAATCCGGTAGAGAAGATGAAGACTGGATTTGCTTACTTTAAGACAGAGAAATATGAAAAAAATCCAGAATTATATGAAGAGCTTTCGAAAGGCCAAAGCCCCAAGTTCATGGTATTTGCGTGCTCAGATTC...

CDS

Download CDS FASTA

762 bp · LXL04_025266|LXL04_025266|OH1004|CDS

ATGGCGGAGGAGTATTCATGCGACGACGCCATTGAAGAACTGAAGAAGCTTCTCAGTGAGAAAAGCGAACTTGAAACTGTCGCCGCCGCTAAAATCAAGCAACTAACGGCTGATCTGGAGAAAGCCGTTAATCCGGTAGAGAAGATGAAGACTGGATTTGCTTACTTTAAGACAGAGAAATATGAAAAAAATCCAGAATTATATGAAGAGCTTTCGAAAGGCCAAAGCCCCAAGTTCATGGTATTTGCGTGCTCAGATTC...

Protein

Download Protein FASTA

253 aa · LXL04_025266|LXL04_025266|OH1004|PROTEIN

MAEEYSCDDAIEELKKLLSEKSELETVAAAKIKQLTADLEKAVNPVEKMKTGFAYFKTEKYEKNPELYEELSKGQSPKFMVFACSDSRVCPSHILDFQPGEAFMVRNIANMVPQYDKIKYSGVGAAIEYAVVHLKVENILVMGHSCCGGIKGLMAIADDGTKHSDFIEDWVSICASAKAKVKAEFGELDISELCTHCEQEAVNVSLGNLLTYPFVKAAVLNKSLSLKGGYYNFLKGSFDFWCLDHGLSPPLTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025266`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025266

Location Chr05:108925354-108927019 (-)

Description Similar to Carbonic anhydrase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01500`	Reversible hydration of carbon dioxide.	Reduction of plastid-localized carbonic anhydrase activity results in reduced Arabidopsis seedling survivorship.2008 · DOI: 10.1104/pp.108.118661 S-nitrosylation of AtSABP3 antagonizes the expression of plant immunity.2009 · DOI: 10.1074/jbc.m806782200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025266 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0010037 response to carbon dioxide Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0015976 carbon utilization Biological Process

GO:0015979 photosynthesis Biological Process

GO:0050832 defense response to fungus Biological Process

GO:2000122 negative regulation of stomatal complex development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT3G01500

nta:107822687

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · LXL04_025266 · OH-1004

Nucleus0.292

Rank 2 · LXL04_025266 · OH-1004

Cell membrane0.126

Rank 3 · LXL04_025266 · OH-1004

Mitochondrion0.093

Rank 4 · LXL04_025266 · OH-1004

Endoplasmic reticulum0.066

Rank 5 · LXL04_025266 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00484.25Pro_CA80-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025266	`PF00484.25`	Pro_CA	80	237	6.9e-43	147.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P27140`	Arabidopsis thaliana	Beta carbonic anhydrase 1, chloroplastic	66.129%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card