LXL04_025247 | RubberDandelionOmics

Gene overview

LXL04_025247

Reference: OH-1004 Chr: Chr05 Coordinates: 108609869-108611418 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · LXL04_025247|LXL04_025247|OH1004|cDNA

ATGGCTGCCAAGATTCTCGCAAATTTGCTAATTATGGGATCAGGAATCTTGGTTAGAGGAATGGTACACGCATATCGCCAGGCCCTTCAAAATGCCTCGAAATCAGGTGTGGCTCAAGAAACATTAAAGAATGCTGTGCGTAGTGGAAGCAAAGCCATGACTGAACAAGAGGCCAGACAAATCCTTGGTGTGACTGACCACTCATCATGGGAGGAAGTTGCACAGAAATATGATAATCTATTTGAGCGAAATGCCAAGAA...

CDS

Download CDS FASTA

357 bp · LXL04_025247|LXL04_025247|OH1004|CDS

ATGGCTGCCAAGATTCTCGCAAATTTGCTAATTATGGGATCAGGAATCTTGGTTAGAGGAATGGTACACGCATATCGCCAGGCCCTTCAAAATGCCTCGAAATCAGGTGTGGCTCAAGAAACATTAAAGAATGCTGTGCGTAGTGGAAGCAAAGCCATGACTGAACAAGAGGCCAGACAAATCCTTGGTGTGACTGACCACTCATCATGGGAGGAAGTTGCACAGAAATATGATAATCTATTTGAGCGAAATGCCAAGAA...

Protein

Download Protein FASTA

118 aa · LXL04_025247|LXL04_025247|OH1004|PROTEIN

MAAKILANLLIMGSGILVRGMVHAYRQALQNASKSGVAQETLKNAVRSGSKAMTEQEARQILGVTDHSSWEEVAQKYDNLFERNAKNGSFYLQSKVHRAKECLETVYQPKDQPGGNVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025247`
TK1151 ID	TkA06G072030
OH-1004 ID	LXL04_025247
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 90.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025247

Location Chr05:108609869-108611418 (-)

Description Similar to PAM16L2: Mitochondrial import inner membrane translocase subunit PAM16 like 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g59280`	Regulates ATP-dependent protein translocation into the mitochondrial matrix (By similarity).	An Arabidopsis mutant resistant to thaxtomin A, a cellulose synthesis inhibitor from Streptomyces species.2003 · DOI: 10.1105/tpc.013342 Enhanced resistance to the cellulose biosynthetic inhibitors, thaxtomin A and isoxaben in Arabidopsis thaliana mutants, also provides specific co-resistance to the auxin transport inhibitor, 1-NPA.2013 · DOI: 10.1186/1471-2229-13-76 Mitochondrial AtPAM16 is required for plant survival and the negative regulation of plant immunity.2013 · DOI: 10.1038/ncomms3558
`At5g61880`	Regulates ATP-dependent protein translocation into the mitochondrial matrix.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025247 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:1902289 negative regulation of defense response to oomycetes Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:2000378 negative regulation of reactive oxygen species metabolic process Biological Process

GO:0001405 PAM complex, Tim23 associated import motor Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT3G59280

ath:AT5G61880

dme:Dmel_CG5268

ncr:NCU05515

spo:2541152

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.949

Rank 1 · LXL04_025247 · OH-1004

Nucleus0.072

Rank 2 · LXL04_025247 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_025247 · OH-1004

Cell membrane0.030

Rank 4 · LXL04_025247 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_025247 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03656.19Pam161-106 aa

PF30912.1TIM141_C51-104 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025247	`PF03656.19`	Pam16	1	106	2.8e-19	70.1
LXL04_025247	`PF30912.1`	TIM141_C	51	104	3.3e-06	27.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VV9`	Arabidopsis thaliana	Mitochondrial import inner membrane translocase subunit PAM16 like 2	70.909%	Swiss-Prot	strong database homology
`Q93W66`	Arabidopsis thaliana	Mitochondrial import inner membrane translocase subunit PAM16 like 1	64.865%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card