LXL04_023866 | RubberDandelionOmics

Gene overview

LXL04_023866

Reference: OH-1004 Chr: Chr05 Coordinates: 71773499-71775782 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1143 bp · LXL04_023866|LXL04_023866|OH1004|cDNA

ATGGCGAATTCAATTTCATCTCTCATCGTTCTGATCGACGATTCACCGAGTACAGTTCGCGATTTGAAGCCAGTCGGACCGATTTTGAATTTGCCGACTGTTCGAGTTCTGCGTGCGGCTCAGTCTCGATTGCGACAGCGACTCTTCGTTTTCATGACGCCTGGCGAGTCTGCCATCCCGACTTCAAACACCCCTTTTCTTCCCTGGAAGGCGCTTGTGAAAGGTGACGTTTTCCTCCCTAATGTTGATTTACAGAAATG...

CDS

Download CDS FASTA

1143 bp · LXL04_023866|LXL04_023866|OH1004|CDS

ATGGCGAATTCAATTTCATCTCTCATCGTTCTGATCGACGATTCACCGAGTACAGTTCGCGATTTGAAGCCAGTCGGACCGATTTTGAATTTGCCGACTGTTCGAGTTCTGCGTGCGGCTCAGTCTCGATTGCGACAGCGACTCTTCGTTTTCATGACGCCTGGCGAGTCTGCCATCCCGACTTCAAACACCCCTTTTCTTCCCTGGAAGGCGCTTGTGAAAGGTGACGTTTTCCTCCCTAATGTTGATTTACAGAAATG...

Protein

Download Protein FASTA

380 aa · LXL04_023866|LXL04_023866|OH1004|PROTEIN

MANSISSLIVLIDDSPSTVRDLKPVGPILNLPTVRVLRAAQSRLRQRLFVFMTPGESAIPTSNTPFLPWKALVKGDVFLPNVDLQKWEMVFMKMVMVNESQTMICERLFEVNFIGATGFSQRICHKDYDILKQAPFLVPFTSRVKLFTSQLAAIKERPGSHSLFNRSTFKIRRDHILEDAFSQLSTLPEEDLRGVIRVTFVNEFGVEEAGIDGGGIFKDFMENITRAAFDMQYGLFKETIDHLLYPNPGSGMIHEQHLQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023866`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023866

Location Chr05:71773499-71775782 (-)

Description Similar to UPL6: E3 ubiquitin-protein ligase UPL6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17205`	Probable E3 ubiquitin-protein ligase which mediates ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023866 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0000209 protein polyubiquitination Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0035519 protein K29-linked ubiquitination Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT3G17205

hsa:89910

hsa:9690

mmu:100763

mmu:117146

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.506

Rank 1 · LXL04_023866 · OH-1004

Nucleus0.419

Rank 2 · LXL04_023866 · OH-1004

Mitochondrion0.122

Rank 3 · LXL04_023866 · OH-1004

Peroxisome0.060

Rank 4 · LXL04_023866 · OH-1004

Cell membrane0.043

Rank 5 · LXL04_023866 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00632.31HECT224-380 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023866	`PF00632.31`	HECT	224	380	4.4e-35	122.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWB8`	Arabidopsis thaliana	E3 ubiquitin-protein ligase UPL6	80.080%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card