LXL04_023862 | RubberDandelionOmics

Gene overview

LXL04_023862

Reference: OH-1004 Chr: Chr05 Coordinates: 71590967-71592146 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_023862|LXL04_023862|OH1004|cDNA

atgaagaagaaaacccaGCAACATCGCCGGAACCCCAACCACACCAGCAACAGCTCGGTGCTTGGTATATTACATAGCCTAATATTCTGCCGCCGCCGCCACCTCGGCAGCCAGCTCCTCCCTCTCTTCTCCGCCCTCATCGGTTGCTTTCTTTTTCTTGTTGCATTCGTATCGTTTCTATCTCCACCAATCAACCACCACCATGTCCATCGTTTGCGTTATAATTATAGCTTGCTTGATGAAGAAATCGATTTTCTATC...

CDS

Download CDS FASTA

663 bp · LXL04_023862|LXL04_023862|OH1004|CDS

ATGAAGAAGAAAACCCAGCAACATCGCCGGAACCCCAACCACACCAGCAACAGCTCGGTGCTTGGTATATTACATAGCCTAATATTCTGCCGCCGCCGCCACCTCGGCAGCCAGCTCCTCCCTCTCTTCTCCGCCCTCATCGGTTGCTTTCTTTTTCTTGTTGCATTCGTATCGTTTCTATCTCCACCAATCAACCACCACCATGTCCATCGTTTGCGTTATAATTATAGCTTGCTTGATGAAGAAATCGATTTTCTATC...

Protein

Download Protein FASTA

220 aa · LXL04_023862|LXL04_023862|OH1004|PROTEIN

MKKKTQQHRRNPNHTSNSSVLGILHSLIFCRRRHLGSQLLPLFSALIGCFLFLVAFVSFLSPPINHHHVHRLRYNYSLLDEEIDFLSHLGIWKYVNFSCSHGDAKTNPERYLLIVTSGGLNQQRTGITDAVAAAYMLNSTLVVPELDNRSYWKDKSNFSDIFDVDWFITYLSKDVHVIKQLPTIEGKPLRPYRTRVPRRCDPECYQSRVLPLLERKKVGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_023862`
TK1151 ID	TkA06G205360
OH-1004 ID	LXL04_023862
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_023862

Location Chr05:71590967-71592146 (-)

Description Similar to OFUT6: O-fucosyltransferase 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g20550`	O-fucosyltransferase 6.	No verified direct reference in this release
`At4g38390`	Protein ROOT HAIR SPECIFIC 17.	No verified direct reference in this release
`At1g76270`	O-fucosyltransferase 16.	No verified direct reference in this release
`At4g16650`	O-fucosyltransferase 29.	No verified direct reference in this release
`At1g22460`	O-fucosyltransferase 7.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023862 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0016020 membrane Cellular Component

GO:0016757 glycosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G20550

ath:AT1G22460

ath:AT1G76270

ath:AT4G16650

ath:AT4G38390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.640

Rank 1 · LXL04_023862 · OH-1004

Endoplasmic reticulum0.139

Rank 2 · LXL04_023862 · OH-1004

Cell membrane0.072

Rank 3 · LXL04_023862 · OH-1004

Cytoplasm0.064

Rank 4 · LXL04_023862 · OH-1004

Lysosome / Vacuole0.052

Rank 5 · LXL04_023862 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250.16O-FucT111-218 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_023862	`PF10250.16`	O-FucT	111	218	3.3e-31	109.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HSU3`	Arabidopsis thaliana	O-fucosyltransferase 6	43.779%	Swiss-Prot	moderate database homology
`Q9SVE6`	Arabidopsis thaliana	Protein ROOT HAIR SPECIFIC 17	47.959%	Swiss-Prot	moderate database homology
`Q949U4`	Arabidopsis thaliana	O-fucosyltransferase 16	48.980%	Swiss-Prot	moderate database homology
`Q8LPF8`	Arabidopsis thaliana	O-fucosyltransferase 29	60.909%	Swiss-Prot	weak database homology
`B7ZWR7`	Arabidopsis thaliana	O-fucosyltransferase 7	63.636%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card