Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1171 bp · LXL04_023710|LXL04_023710|OH1004|cDNA
GAGGAAATCGGAGGTCAATTCTCCCTCTCGAGCGATTTCAACTCCTCCGATCTCTCTCTGTAAAGTGCTCATGGCGTTTTCCGACAACTCTCGACAATCTCTCATCCCTAATTACCTATACACTTCGTCTTCAACTACCAGCCTACTCATGGGCAAATCCATCAATCATTCAAACTCAAGCTTGTTTCCTTCTCCTTCACCTCCGAAGGACCACCAAAACTTCATGATAGCTTCTCCCAGTGAGCCTTTTGGTAAGATCG...
1101 bp · LXL04_023710|LXL04_023710|OH1004|CDS
ATGGCGTTTTCCGACAACTCTCGACAATCTCTCATCCCTAATTACCTATACACTTCGTCTTCAACTACCAGCCTACTCATGGGCAAATCCATCAATCATTCAAACTCAAGCTTGTTTCCTTCTCCTTCACCTCCGAAGGACCACCAAAACTTCATGATAGCTTCTCCCAGTGAGCCTTTTGGTAAGATCGAGATGTACTCGCCTAGATTCTACGCTGCTTGTACAGCTGGTGGTATTCTCAGCTGTGGTCTCACTCACAT...
Protein
Download Protein FASTA366 aa · LXL04_023710|LXL04_023710|OH1004|PROTEIN
MAFSDNSRQSLIPNYLYTSSSTTSLLMGKSINHSNSSLFPSPSPPKDHQNFMIASPSEPFGKIEMYSPRFYAACTAGGILSCGLTHMTVTPLDLVKCNMQIDPVKYKSISSGFGVLLKEQGVRGFFRGWVPTLLGYSAQGACKFGFYEFFKKYYSDIAGPEYAAKYKTLIYLAGSASAEIIADVALCPMEAVKVRVQTQPGFARGLGDGLPKFIKSEGALGLYKGLVPLWGRQIPYTMMKFASFETIVENLYKYAIPTPK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_023710 |
|---|---|
| TK1151 ID | TkA06G237340 |
| OH-1004 ID | LXL04_023710 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_023710 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:64374850-64376997 (+) | |||||||||
| Description | Similar to MPT3: Mitochondrial phosphate carrier protein 3, mitochondrial | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009651 response to salt stress Biological Process GO:0035435 phosphate ion transmembrane transport Biological Process GO:1990547 mitochondrial phosphate ion transmembrane transport Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0009507 chloroplast Cellular Component GO:0003729 mRNA binding Molecular Function GO:0005315 phosphate transmembrane transporter activity Molecular Function GO:0015317 phosphate:proton symporter activity Molecular Function GO:0044877 protein-containing complex binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT3G48850 ath:AT5G14040 mmu:18674 pon:100173229 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00153.33Mito_carr71-156 aaPF00153.33Mito_carr167-253 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_023710 | PF00153.33 | Mito_carr | 71 | 156 | 8.5e-46 | 154.4 |
| LXL04_023710 | PF00153.33 | Mito_carr | 167 | 253 | 8.5e-46 | 154.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.