LXL04_022226 | RubberDandelionOmics

Gene overview

LXL04_022226

Reference: OH-1004 Chr: Chr04 Coordinates: 146466701-146470865 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2518 bp · LXL04_022226|LXL04_022226|OH1004|cDNA

ATGTATTGTTCTTTGGGTATGCTTCCTAAAGCTCATATTGGGTTTCTAACACAATTCTCTATTAAAGATTCATCAATGGCTACAGGAAGCAACTCTTATATCCCTCCACCACAGCTTACAAAACTTATCGTGGGACCCAGAAATCAGGCCTTCAGTTCAAGCCTTCTTCGTACCCCAAAATTATTTGCCCATTGTCAGGCGAACCATGATTCAGCTGTTGTGACTGATGATGAGCTTTCATCAATGACAAACATTAAAGC...

CDS

Download CDS FASTA

2490 bp · LXL04_022226|LXL04_022226|OH1004|CDS

ATGTATTGTTCTTTGGGTATGCTTCCTAAAGCTCATATTGGGTTTCTAACACAATTCTCTATTAAAGATTCATCAATGGCTACAGGAAGCAACTCTTATATCCCTCCACCACAGCTTACAAAACTTATCGTGGGACCCAGAAATCAGGCCTTCAGTTCAAGCCTTCTTCGTACCCCAAAATTATTTGCCCATTGTCAGGCGAACCATGATTCAGCTGTTGTGACTGATGATGAGCTTTCATCAATGACAAACATTAAAGC...

Protein

Download Protein FASTA

829 aa · LXL04_022226|LXL04_022226|OH1004|PROTEIN

MYCSLGMLPKAHIGFLTQFSIKDSSMATGSNSYIPPPQLTKLIVGPRNQAFSSSLLRTPKLFAHCQANHDSAVVTDDELSSMTNIKADMKTPRILKLDPALGPYKDHFEHRLKRFSEQKMLIEQHEGSLEEFAKGYLKFGLNKEEGGIVYREWAPAAEEAQLIGDFNGWDGSNHKMERNQFGVWSIKIPDVDGNPSIHHNSKVKFRFKSNGVWIYRIPAWIKYATVDSSRFAAPYDGVYWDPPPSERYEFKYPRPPKPKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022226`
TK1151 ID	TkA05G451960
OH-1004 ID	LXL04_022226
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.900
Protein coverage (%)	TK1151 97.017 / OH-1004 98.070 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022226

Location Chr04:146466701-146470865 (+)

Description Similar to SBE1: 1,4-alpha-glucan-branching enzyme

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36390`	Catalyzes the formation of the alpha-1,6-glucosidic linkages in starch by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0726400`	Catalyzes the formation of the alpha-1,6-glucosidic linkages in starch by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the subsequent attachment of the oligosaccharide to the alpha-1,6 position.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022226 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0005978 glycogen biosynthetic process Biological Process

GO:0005982 starch metabolic process Biological Process

GO:0005983 starch catabolic process Biological Process

GO:0010021 amylopectin biosynthetic process Biological Process

GO:0019252 starch biosynthetic process Biological Process

GO:0071329 cellular response to sucrose stimulus Biological Process

GO:0071332 cellular response to fructose stimulus Biological Process

GO:0071333 cellular response to glucose stimulus Biological Process

GO:0071482 cellular response to light stimulus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009501 amyloplast Cellular Component

KEGG gene cross-reference

ath:AT2G36390

sot:102596498

zma:542238

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.935

Rank 1 · LXL04_022226 · OH-1004

Cytoplasm0.065

Rank 2 · LXL04_022226 · OH-1004

Mitochondrion0.038

Rank 3 · LXL04_022226 · OH-1004

Cell membrane0.036

Rank 4 · LXL04_022226 · OH-1004

Peroxisome0.034

Rank 5 · LXL04_022226 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02922.25CBM_48138-220 aa

PF00128.32Alpha-amylase312-399 aa

PF02806.25Alpha-amylase_C673-773 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022226	`PF02922.25`	CBM_48	138	220	2.3e-20	73.4
LXL04_022226	`PF00128.32`	Alpha-amylase	312	399	2.1e-12	47.7
LXL04_022226	`PF02806.25`	Alpha-amylase_C	673	773	2.6e-22	79.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23647`	Arabidopsis thaliana	1,4-alpha-glucan-branching enzyme 2-1, chloroplastic/amyloplastic	56.914%	Swiss-Prot	strong database homology
`Q01401`	Oryza sativa subsp. japonica	1,4-alpha-glucan-branching enzyme, chloroplastic/amyloplastic	76.695%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card