LXL04_022206 | RubberDandelionOmics

Gene overview

LXL04_022206

Reference: OH-1004 Chr: Chr04 Coordinates: 146078753-146079280 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

528 bp · LXL04_022206|LXL04_022206|OH1004|cDNA

ATGAAATTAGGTGACGATGCTTCAGCTACAAGTTCTTCGGTTTCTTCCTTCGGTAAATTCTTCAAGCAATTAGCATCCCCCACTAGGAAACCCCCGATTCCTGGCGGTTCCGATGACATCCATCAGGTGTTTAATTACTTTGACGAGAACGGAGACGGGAAGATATCTCCCGAGGAGCTGAAGAACAGGTTTAGGAAGGTAGGCGGGGAGGAGAGTCAGTTATCGGACGAGGAGGCGGAGATGGTAGTGCGGTTGTCGGA...

CDS

Download CDS FASTA

528 bp · LXL04_022206|LXL04_022206|OH1004|CDS

ATGAAATTAGGTGACGATGCTTCAGCTACAAGTTCTTCGGTTTCTTCCTTCGGTAAATTCTTCAAGCAATTAGCATCCCCCACTAGGAAACCCCCGATTCCTGGCGGTTCCGATGACATCCATCAGGTGTTTAATTACTTTGACGAGAACGGAGACGGGAAGATATCTCCCGAGGAGCTGAAGAACAGGTTTAGGAAGGTAGGCGGGGAGGAGAGTCAGTTATCGGACGAGGAGGCGGAGATGGTAGTGCGGTTGTCGGA...

Protein

Download Protein FASTA

175 aa · LXL04_022206|LXL04_022206|OH1004|PROTEIN

MKLGDDASATSSSVSSFGKFFKQLASPTRKPPIPGGSDDIHQVFNYFDENGDGKISPEELKNRFRKVGGEESQLSDEEAEMVVRLSDADGDGVLGFDDFTKMMKEGEDGELREAFVMYSGKSSREEGVITPKSLKKMLTRLGQSPTVNECTAMIGKFDVNGDGVLDFEEFRAMMN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022206`
TK1151 ID	TkA05G450450
OH-1004 ID	LXL04_022206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022206

Location Chr04:146078753-146079280 (+)

Description Similar to CML38: Calcium-binding protein CML38

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76650`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0
`At1g76640`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0
`At3g50770`	Potential calcium sensor.	No verified direct reference in this release
`At5g42380`	Potential calcium sensor that binds calcium in vitro.	Developmental and stimulus-induced expression patterns of Arabidopsis calmodulin-like genes CML37, CML38 and CML39.2007 · DOI: 10.1007/s11103-007-9189-0

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0955100`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022206 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0010193 response to ozone Biological Process

GO:0033198 response to ATP Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1900459 positive regulation of brassinosteroid mediated signaling pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G76640

ath:AT1G76650

ath:AT3G50770

ath:AT5G42380

dosa:Os01g0955100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.310

Rank 1 · LXL04_022206 · OH-1004

Nucleus0.248

Rank 2 · LXL04_022206 · OH-1004

Plastid0.153

Rank 3 · LXL04_022206 · OH-1004

Endoplasmic reticulum0.144

Rank 4 · LXL04_022206 · OH-1004

Mitochondrion0.123

Rank 5 · LXL04_022206 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_738-104 aa

PF00036.39EF-hand_139-66 aa

PF13405.13EF-hand_639-68 aa

PF13202.13EF-hand_541-62 aa

PF13833.13EF-hand_872-104 aa

PF00036.39EF-hand_180-105 aa

PF13499.13EF-hand_7126-174 aa

PF13833.13EF-hand_8126-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022206	`PF13499.13`	EF-hand_7	38	104	1.7e-26	93.0
LXL04_022206	`PF00036.39`	EF-hand_1	39	66	4.3e-21	73.5
LXL04_022206	`PF13405.13`	EF-hand_6	39	68	1.7e-18	65.3
LXL04_022206	`PF13202.13`	EF-hand_5	41	62	1.6e-17	62.8
LXL04_022206	`PF13833.13`	EF-hand_8	72	104	5e-22	78.1
LXL04_022206	`PF00036.39`	EF-hand_1	80	105	4.3e-21	73.5
LXL04_022206	`PF13499.13`	EF-hand_7	126	174	1.7e-26	93.0
LXL04_022206	`PF13833.13`	EF-hand_8	126	174	5e-22	78.1
LXL04_022206	`PF00036.39`	EF-hand_1	150	174	4.3e-21	73.5
LXL04_022206	`PF13405.13`	EF-hand_6	156	174	1.7e-18	65.3
LXL04_022206	`PF13202.13`	EF-hand_5	156	174	1.6e-17	62.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRE6`	Arabidopsis thaliana	Calcium-binding protein CML38	45.143%	Swiss-Prot	moderate database homology
`Q9SRE7`	Arabidopsis thaliana	Calcium-binding protein CML39	45.000%	Swiss-Prot	moderate database homology
`Q8L3R2`	Arabidopsis thaliana	Probable calcium-binding protein CML41	45.890%	Swiss-Prot	moderate database homology
`Q9FIH9`	Arabidopsis thaliana	Calcium-binding protein CML37	48.611%	Swiss-Prot	moderate database homology
`Q8RYK0`	Oryza sativa subsp. japonica	Probable calcium-binding protein CML31	46.809%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card