LXL04_022105 | RubberDandelionOmics

Gene overview

LXL04_022105

Reference: OH-1004 Chr: Chr04 Coordinates: 144805028-144809750 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2181 bp · LXL04_022105|LXL04_022105|OH1004|cDNA

ATGGGTTCGAGTCCGATGGTGGGCATTACCGGCGGAGCGTCTGATAAAACCCACGGGTTCCGGAGGCTTGTACACGACAATGGCGGTGGCCATTCACCGACTGTGCACTATCTTTTCGTCTCGTTTTTGTTGTGCAGCTCGGTTGGGGTTTTCTATATCTTTTACTTATTCAACAACCCTAATTTGAGCTATAATAATTCACTCGGTTGTCAAGAGGATAACGATGGTTCATGGGCAATCGGGGCTTTCTATGGGGATTC...

CDS

Download CDS FASTA

2181 bp · LXL04_022105|LXL04_022105|OH1004|CDS

ATGGGTTCGAGTCCGATGGTGGGCATTACCGGCGGAGCGTCTGATAAAACCCACGGGTTCCGGAGGCTTGTACACGACAATGGCGGTGGCCATTCACCGACTGTGCACTATCTTTTCGTCTCGTTTTTGTTGTGCAGCTCGGTTGGGGTTTTCTATATCTTTTACTTATTCAACAACCCTAATTTGAGCTATAATAATTCACTCGGTTGTCAAGAGGATAACGATGGTTCATGGGCAATCGGGGCTTTCTATGGGGATTC...

Protein

Download Protein FASTA

726 aa · LXL04_022105|LXL04_022105|OH1004|PROTEIN

MGSSPMVGITGGASDKTHGFRRLVHDNGGGHSPTVHYLFVSFLLCSSVGVFYIFYLFNNPNLSYNNSLGCQEDNDGSWAIGAFYGDSPFSLKPIEAMNIWDNKSAAWPIANPILTCASVTDSGFPSNYVADPFLYAQDDILYMFFETKNMITMKGDIAVARSKDNGASWEQLGVVLDEDWHLSHPYVFNYNNQIYMMPQGLGTRDIRVYRAIDFPSKWEFEKIILQRPLLNSIIVQHKKMYWIIGSFQSRLTYGDLEIWH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022105`
TK1151 ID	TkA05G445590
OH-1004 ID	LXL04_022105
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.900
Protein coverage (%)	TK1151 96.658 / OH-1004 51.791 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022105

Location Chr04:144805028-144809750 (+)

Description Similar to GINT1: Glucosamine inositolphosphorylceramide transferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04500`	Glycosyltransferase that mediates the glycosylation of glycosylinositol phosphorylceramides (GIPCs), the major sphingolipids in the plasma membrane.	GLUCOSAMINE INOSITOLPHOSPHORYLCERAMIDE TRANSFERASE1 (GINT1) Is a GlcNAc-Containing Glycosylinositol Phosphorylceramide Glycosyltransferase.2018 · DOI: 10.1104/pp.18.00396

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0540000`	Essential protein.	GLUCOSAMINE INOSITOLPHOSPHORYLCERAMIDE TRANSFERASE1 (GINT1) Is a GlcNAc-Containing Glycosylinositol Phosphorylceramide Glycosyltransferase.2018 · DOI: 10.1104/pp.18.00396
`UniProt: A2Y6Z7`	Essential protein.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022105 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006044 N-acetylglucosamine metabolic process Biological Process

GO:0006688 glycosphingolipid biosynthetic process Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009845 seed germination Biological Process

GO:0015012 heparan sulfate proteoglycan biosynthetic process Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0019276 UDP-N-acetylgalactosamine metabolic process Biological Process

GO:0030210 heparin proteoglycan biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT5G04500

dme:Dmel_CG8433

dosa:Os05g0540000

mmu:58193

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.631

Rank 1 · LXL04_022105 · OH-1004

Endoplasmic reticulum0.230

Rank 2 · LXL04_022105 · OH-1004

Cytoplasm0.098

Rank 3 · LXL04_022105 · OH-1004

Cell membrane0.062

Rank 4 · LXL04_022105 · OH-1004

Lysosome / Vacuole0.053

Rank 5 · LXL04_022105 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24793.2GINT1_N70-358 aa

PF09258.17Glyco_transf_64473-705 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022105	`PF24793.2`	GINT1_N	70	358	3.2e-134	447.4
LXL04_022105	`PF09258.17`	Glyco_transf_64	473	705	4.6e-63	213.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84WB7`	Arabidopsis thaliana	Glucosamine inositolphosphorylceramide transferase 1	54.913%	Swiss-Prot	strong database homology
`Q53WK1`	Oryza sativa subsp. japonica	Glucosamine inositolphosphorylceramide transferase 1	48.365%	Swiss-Prot	moderate database homology
`A2Y6Z7`	Oryza sativa subsp. indica	Glucosamine inositolphosphorylceramide transferase 1	48.229%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card