LXL04_022050 | RubberDandelionOmics

Gene overview

LXL04_022050

Reference: OH-1004 Chr: Chr04 Coordinates: 144046498-144047343 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

732 bp · LXL04_022050|LXL04_022050|OH1004|cDNA

ATGGCCGCCGCAGCACCACCACCACTGCCGACCACCACACCGGAACTCAACATGGATCTCCCGAACAACTACCCACTCTTCACCAGGATCCGCCTGGCCACCAGAACCGACGTCCCTGTCATCCACAAAATGATCTACCAAATGGCCTTATTCGAACGCCTCGCCAACGAATGCTCCGCCACCGAACCTTCCCTTGCCACCACCCTCTTCTCCAAAGACAACCCCTTCGAATCCTTCACCGTGTTCCTAATCGAAGCTTC...

CDS

Download CDS FASTA

732 bp · LXL04_022050|LXL04_022050|OH1004|CDS

ATGGCCGCCGCAGCACCACCACCACTGCCGACCACCACACCGGAACTCAACATGGATCTCCCGAACAACTACCCACTCTTCACCAGGATCCGCCTGGCCACCAGAACCGACGTCCCTGTCATCCACAAAATGATCTACCAAATGGCCTTATTCGAACGCCTCGCCAACGAATGCTCCGCCACCGAACCTTCCCTTGCCACCACCCTCTTCTCCAAAGACAACCCCTTCGAATCCTTCACCGTGTTCCTAATCGAAGCTTC...

Protein

Download Protein FASTA

243 aa · LXL04_022050|LXL04_022050|OH1004|PROTEIN

MAAAAPPPLPTTTPELNMDLPNNYPLFTRIRLATRTDVPVIHKMIYQMALFERLANECSATEPSLATTLFSKDNPFESFTVFLIEASTKPFPPSSIGHHPKFTPIHKTLNLDYPISDPESEVFKSSTMEDGVIVAGFVLFFPNYSTFLAKPGFYIEDLFVRESYRRKGLGKMLLSAVARQAVAMGYGRVEWVVLDWNTNAIKFYEEMGANVMKEWRESERWIRVFWWWYNVNCLISPFPDVKT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022050`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022050

Location Chr04:144046498-144047343 (-)

Description Similar to At2g39020: Probable acetyltransferase NATA1-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39020`	Probable protein acetyltransferase with dual specificity triggering both N-alpha-acetylation (NTA) and epsilon-lysine acetylation (KA).	No verified direct reference in this release
`At2g39030`	Acetyltransferase that converts ornithine to N5- acetylornithine, which is likely used in plant defense.	Biosynthesis and defensive function of Nδ-acetylornithine, a jasmonate-induced Arabidopsis metabolite.2011 · DOI: 10.1105/tpc.111.088989

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022050 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006591 ornithine metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009447 putrescine catabolic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0070458 cellular detoxification of nitrogen compound Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004145 diamine N-acetyltransferase activity Molecular Function

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0008080 N-acetyltransferase activity Molecular Function

GO:0050366 tyramine N-feruloyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G39020

ath:AT2G39030

nta:107789681

nta:107822189

spo:2543272

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.729

Rank 1 · LXL04_022050 · OH-1004

Nucleus0.463

Rank 2 · LXL04_022050 · OH-1004

Peroxisome0.062

Rank 3 · LXL04_022050 · OH-1004

Mitochondrion0.056

Rank 4 · LXL04_022050 · OH-1004

Plastid0.048

Rank 5 · LXL04_022050 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00583.32Acetyltransf_1115-208 aa

PF13508.14Acetyltransf_7130-208 aa

PF13673.14Acetyltransf_10134-213 aa

PF08445.17FR47148-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022050	`PF00583.32`	Acetyltransf_1	115	208	1.2e-18	68.2
LXL04_022050	`PF13508.14`	Acetyltransf_7	130	208	1.1e-10	42.4
LXL04_022050	`PF13673.14`	Acetyltransf_10	134	213	2.1e-08	34.9
LXL04_022050	`PF08445.17`	FR47	148	212	1.7e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV06`	Arabidopsis thaliana	GCN5-related N-acetyltransferase 8	66.497%	Swiss-Prot	strong database homology
`Q9ZV05`	Arabidopsis thaliana	L-ornithine N5-acetyltransferase NATA1	58.333%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card