LXL04_022008 | RubberDandelionOmics

Gene overview

LXL04_022008

Reference: OH-1004 Chr: Chr04 Coordinates: 142382512-142384680 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · LXL04_022008|LXL04_022008|OH1004|cDNA

ATGAGGCAAGAAGCTGAAGAAACATTTAATTCCATGGTGAGATCGGGTATTAAACCCGATCTACTTGCTTATTCGGTAATGTTAGATGTTTTATTAAGATTTGATGTAGGTAAAGCTATGATGTTGTATAACAACATGGTTCGTGATGGGTTCACACTTGATTTGTCGCTTTATGAGCTTTTAATGAAATCTCTTCACCATGAAAACAGAGAAAATCAGGTTGAAAAGGTAATTGAAGATATGCGGAAGTTATGTAATTT...

CDS

Download CDS FASTA

1233 bp · LXL04_022008|LXL04_022008|OH1004|CDS

ATGAGGCAAGAAGCTGAAGAAACATTTAATTCCATGGTGAGATCGGGTATTAAACCCGATCTACTTGCTTATTCGGTAATGTTAGATGTTTTATTAAGATTTGATGTAGGTAAAGCTATGATGTTGTATAACAACATGGTTCGTGATGGGTTCACACTTGATTTGTCGCTTTATGAGCTTTTAATGAAATCTCTTCACCATGAAAACAGAGAAAATCAGGTTGAAAAGGTAATTGAAGATATGCGGAAGTTATGTAATTT...

Protein

Download Protein FASTA

410 aa · LXL04_022008|LXL04_022008|OH1004|PROTEIN

MRQEAEETFNSMVRSGIKPDLLAYSVMLDVLLRFDVGKAMMLYNNMVRDGFTLDLSLYELLMKSLHHENRENQVEKVIEDMRKLCNLNPQVISSTLVKGGSYDYAAKMFKLAILEGYDLDHESLLSILSSYSSSGRHPEALDLLDFLKEHAPESGRIITEALIVILCRSNQLDAAIDEYRKSRNSNTLSGSSSMYESLIEGSLKIDGDGEPVKKMESRFTHEMGINVLCEESDYSYSYSYSQSPPSSPPVVLSPCAACKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_022008`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_022008

Location Chr04:142382512-142384680 (+)

Description Similar to LBD1: LOB domain-containing protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18110`	May play a role in embryogenesis.	No verified direct reference in this release
`At1g07900`	LOB domain-containing protein 1.	No verified direct reference in this release
`At2g28500`	LOB domain-containing protein 11.	No verified direct reference in this release
`At2g30130`	LOB domain-containing protein 12.	No verified direct reference in this release
`At1g16530`	LOB domain-containing protein 3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022008 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0048364 root development Biological Process

GO:0080117 secondary growth Biological Process

GO:2000377 regulation of reactive oxygen species metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G07900

ath:AT1G16530

ath:AT2G28500

ath:AT2G30130

ath:AT3G18110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.799

Rank 1 · LXL04_022008 · OH-1004

Cytoplasm0.170

Rank 2 · LXL04_022008 · OH-1004

Cell membrane0.043

Rank 3 · LXL04_022008 · OH-1004

Mitochondrion0.037

Rank 4 · LXL04_022008 · OH-1004

Plastid0.032

Rank 5 · LXL04_022008 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_23-31 aa

PF03195.20LOB254-351 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_022008	`PF13041.13`	PPR_2	3	31	2.4e-13	50.7
LXL04_022008	`PF03195.20`	LOB	254	351	4.1e-40	137.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5G1S8`	Arabidopsis thaliana	Pentatricopeptide repeat-containing protein At3g18110, chloroplastic	56.000%	Swiss-Prot	weak database homology
`Q9LQR0`	Arabidopsis thaliana	LOB domain-containing protein 1	62.874%	Swiss-Prot	weak database homology
`Q9SK08`	Arabidopsis thaliana	LOB domain-containing protein 11	57.609%	Swiss-Prot	weak database homology
`Q8LBW3`	Arabidopsis thaliana	LOB domain-containing protein 12	66.038%	Swiss-Prot	weak database homology
`Q9SA51`	Arabidopsis thaliana	LOB domain-containing protein 3	59.633%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card